KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2008Help
Entry
Calkro_2008       CDS       T01357                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Brite
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Calkro_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188122..2190191)
Genome map
AA seq 689 aa AA seqDB search
MSCCFYRRLKRFSVLILVILFLIVTLIGIESTKISRVIGETKKSFVEYNFENRFIAPFKA
SGKSMSLRIDNTTAAEGTFSLLASGRKQIDDGILLDVTNLIDYANEYKITLYVYHKSSKM
QRFVVSSEIETKSGKENKLLCEKIIIPKSWKKLDASLNLTEEKGIKKVWLKVYVPTSTTN
FYVDLFTLKVADKSHLIKFENFEDKNIAGFISQDKKCKLSISKEKAYQGTYSIKVQQTVK
RQNTTVILPVKGTFEKGKSYSISFYMHQSILKSLNFAVGIRFLESGKNMREIVLGRVTIP
KNKWTEVFASYTPSLDSKIKDFVIFIRPLSDISYYYIDNFTISDDGWYSAVPDLDLPSLR
EKYKNYFKIGVAVPYRALTNPVDVAFIKRHFNSITAENEMKPEALEPIEDNFNFSIADEY
LNFCKKNNIAIRGHTLVWHQQTPNWFFENPQTGKKLTNSEKDKKILLERLKKYIQTVVSR
YKGRIYAWDVVNEAIDENEPDGFRRSDWFNVLGPEYIEKAFIYAHQADPNAQLFYNDYST
ENPVKREYIYKLIKSLREKGIPIHGVGLQCHISVSWPSVEEVEKTIKLFSSIPGIKIHVT
EIDISVAKEYGKDIDEETKRYLLIQQARKLKDLFDVFKKYKNVVTSVSFWGLKDDYSWLQ
GDFPLLFDKDYQPKFAFWSLIDPSVVPEE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtgagttgttgcttttatagaagattgaaaaggttttcagtattgattttagtaatttta
tttttgattgtaaccttaattggtatagaaagtactaaaattagtagagtcattggagaa
acaaaaaagagttttgtggagtataattttgaaaataggtttatagcaccatttaaagcg
tcaggaaaatctatgagtttaaggattgacaatacaacagcagcagaagggaccttttca
cttcttgcaagtggccgaaaacaaatagatgatggaattttgcttgatgtaaccaatctt
atagattatgcaaatgaatataaaattactctatatgtttatcacaagtcaagcaaaatg
cagcgttttgttgtgagtagcgaaattgagacaaaaagcggaaaagaaaacaaactgctg
tgtgaaaaaattattattccaaaaagttggaaaaaacttgatgcaagtttaaatttgact
gaggaaaaagggataaaaaaagtttggctaaaagtatatgtaccaacctcaaccacaaat
ttttacgttgacctttttacactcaaagttgctgacaaatctcatctaataaaatttgaa
aactttgaagataaaaatatagcaggatttatctctcaagataaaaaatgtaaattatcc
atttcaaaagaaaaagcttaccaaggtacatatagcataaaagttcagcaaacagttaaa
agacaaaacacaacagttatcttgcctgtaaaaggaacatttgaaaaggggaaaagttat
tcaatatctttttatatgcatcaatccattctaaagagtttaaattttgcagttggtata
aggtttctggaaagtggaaagaatatgagagagattgtgcttgggagggtaaccattcca
aagaataagtggacagaagtatttgcaagttatacgccctctttggattcaaagataaaa
gactttgtgattttcataagacccctctcagatatttcctattactatatcgacaacttt
acaatttcagatgatggatggtattcagctgtacctgatttagatttaccttctttgaga
gagaaatacaaaaactactttaaaattggtgttgctgtaccatacagggctttgacaaat
ccagttgatgttgctttcataaagagacattttaacagcattacagcagagaatgagatg
aagccagaagcacttgaaccaatagaggacaatttcaacttttcaattgctgatgagtat
cttaatttctgcaaaaagaataatatagctattcgtggtcacacacttgtgtggcatcag
caaaccccaaactggttttttgaaaaccctcagacagggaaaaagctgacgaatagtgaa
aaagacaaaaagatacttttagagaggctaaaaaagtatatccagacagttgtttcaaga
tacaagggtagaatatatgcatgggatgtggtaaatgaagctattgatgaaaatgagcca
gatggatttagaagaagtgactggtttaatgtattgggtccagagtatatcgaaaaagcg
ttcatatacgctcatcaggcagaccctaacgctcagcttttttacaatgactacagcaca
gaaaatccagtaaagagagaatatatttacaagctaataaagagtctaagagaaaaagga
atacccattcatggtgttggtcttcagtgccatatttctgtaagctggccaagcgttgaa
gaggtagaaaaaactataaaactttttagcagcattcctggtattaagatacatgtcaca
gaaattgatataagtgtggcaaaagaatatggcaaagacatagatgaagaaacaaaaaga
tatcttttaattcagcaggcaagaaagttaaaagatctttttgatgtgttcaaaaaatac
aaaaatgtagtaacaagtgtttcgttctggggactcaaagatgactattcatggcttcaa
ggtgattttccacttttgtttgacaaagattatcagccaaaatttgctttctggagctta
atagacccgtcagttgtgccagaagaataa

DBGET integrated database retrieval system