KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2076Help
Entry
Calkro_2076       CDS       T01357                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ckn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2267484..2269418
Genome map
AA seq 644 aa AA seqDB search
MIKKVKSTIYLSDIKKFESGEHFESYKFLGSRVVNYRGKVGTVFCVWAPNAKSVSVVGNF
NNWHGENHKMMRVYGSGFWWLFVEGIGEGELYKYEIIGADGKRVLKADPYAIYSEKRPNT
ASIVKNIPDYEWHDQEWMEKRKTTPPYDKPINIYEVHLASWKMKKDGSIEKAGEFYNYRE
LAHMLVDYIKEMNYNYIELLPVLEHPLDMSWGYQPTGYFSLTSRYGSIEDFMYFVDYMHQ
NGIGVIIDWVPAHFCKDEHGLYRFDGTFLYEYEDELLRENYTWGTATFDFSKPQVQSFLI
SSAMFWFDVYHIDGIRVDAVSHIIYMNNNQKNRYGGHENIEGIEFIKKLNKAIFSKYPNV
LMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKYMQKHPDERKYHHNFLTFSIMY
AFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANLRLLYGYMYTHPGKKLLFMGGEFG
QFIEWRFYASLDWLLLDYPMHRMLQHYVKSLNRFYLENKALWELDHKMDGFRWIDVHNWE
QSVISYLRFSKEPDDYLVVICNFGLASYENYKIGVPRKGIYLEVFNSDKAEFGGNNIVNT
EKLKTIDEVWHGYNQCIEFRLPALSCLIFKPIEFFNAQEEKESK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtaaaatctactatttatctatctgatataaaaaaatttgaatcagga
gaacattttgaaagttataagttcttaggaagcagggttgtaaactacagaggcaaggtt
gggacagttttctgtgtgtgggcaccaaatgctaaaagcgtatctgttgttggaaatttt
aataattggcacggcgaaaaccataagatgatgagagtttatggaagtgggttttggtgg
ctatttgtagaaggaattggtgaaggagagctctacaaatatgaaattattggtgctgat
gggaaaagggttttaaaagctgacccgtatgcaatctattctgagaaacgtcccaataca
gcatcaattgtcaaaaacatcccggactatgaatggcatgaccaggaatggatggaaaaa
agaaaaaccactccaccatatgacaagcccatcaatatctatgaggtgcatcttgcatca
tggaaaatgaaaaaggatggaagcatagagaaggctggcgagttttataattaccgcgaa
cttgcccacatgctggtagactacataaaagaaatgaactataactacattgaacttctg
ccagttttagaacatcctcttgacatgtcatggggttaccagccaacaggttacttttct
ctcacatcacgctacggtagtattgaggattttatgtattttgttgactatatgcaccaa
aatggaattggagtaataattgactgggtgccagctcatttttgcaaagatgagcatgga
ctttataggtttgacggaacatttttatatgaatatgaggatgaacttttgagagaaaac
tacacatggggtactgctacatttgacttctcaaaaccccaggttcaaagctttcttatc
tcaagcgccatgttttggtttgatgtttatcacattgacggaataagggtagatgctgtt
tctcacatcatctatatgaacaacaaccagaaaaacaggtatggcggacatgaaaacata
gaaggaattgaatttataaaaaagctcaacaaggcaatattctcaaaatatccaaatgtt
ttgatgattgccgaagagtcaactgcatttcctctggtcacatatccaacatacgatgga
gggcttggctttaattacaagtggaatatgggatggatgaacgacactttaaagtacatg
caaaaacaccctgatgaaagaaagtatcaccataatttcttgacattttctataatgtat
gcattttctgaaaatttcattttacctttttctcatgatgaggttgttcacgggaaaaaa
tctttgcttgacaaaatgccaggtgattacaatcaaaaatttgcaaacctaagacttctt
tacggttatatgtacactcatccgggcaaaaagctccttttcatgggtggtgagtttggt
cagttcattgaatggagattttatgcatcgcttgactggctacttttggactaccccatg
caccgcatgcttcagcactatgttaaaagtttaaacagattctacttagaaaacaaagct
ctgtgggagcttgaccataaaatggatggttttagatggatagatgttcacaactgggag
caaagtgtcatatcatacttgagattttccaaagaacctgatgattaccttgttgtcatt
tgtaactttggtcttgcttcatatgaaaattacaaaataggcgtgccaagaaaaggcatt
tatctggaagtatttaacagtgataaagctgaatttggtggtaataatatagtaaacaca
gaaaaacttaaaacaattgatgaagtgtggcatgggtataaccagtgtatagaatttagg
cttcctgcactttcgtgtttgattttcaagccaattgaatttttcaatgctcaagaagaa
aaagaatcaaaatga

DBGET integrated database retrieval system