KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2082Help
Entry
Calkro_2082       CDS       T01357                                 

Definition
glucokinase, rok family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calkro_2082
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_2082
   00052 Galactose metabolism
    Calkro_2082
   00500 Starch and sucrose metabolism
    Calkro_2082
   00520 Amino sugar and nucleotide sugar metabolism
    Calkro_2082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calkro_2082
   00524 Butirosin and neomycin biosynthesis
    Calkro_2082
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calkro_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2276454..2277404)
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEGGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLTL
DDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTKISVTITLGTGIGGGIIIDGKIFTGAHHAGAELGHMVICVDGEQCTCGRRGC
WEAYASATALIRMTREAAARDINGTIMKLVNGDISKIDAKTAFDAKRMGDSTGAAIVDRY
VKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRKLVYEKFYCKQVPMPKIIPAVL
GNDAGIIGAALLAKQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgacttgggaggaacaaacattgcagcaggaattgttgatgag
ggaggaaaaattataaaaaaaggttctgtgccaacaggagcgcacagacattatacagag
attatgaaggatatggctgagctatctttaaatcttgtaaaggaatgtggacttacactt
gatgatattcattctgttggaattggaagtccaggtgcacctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtgcctatgagagaagagatacaaaaa
tacattccaaagcctgttaacatagaaaacgatgcgaactgtgcagcatatggtgagtat
atagcaggcggtgcaaaaggcacaaagatttctgttacaattacattgggaactggcatt
ggcgggggaattataatcgatggcaaaatattcaccggggcacaccatgcaggtgcagag
ctggggcatatggtaatttgtgttgatggtgagcagtgcacatgtggcagaagaggttgc
tgggaggcttatgcttcagcaacagctcttattcgaatgacaagagaggctgctgcaagg
gatataaacggcactatcatgaagcttgtaaatggtgatatttcaaagattgatgccaaa
acagcttttgatgcaaagcgaatgggagacagcactggtgcagcaattgttgacaggtat
gtaaaataccttgctgaaggccttgcaaacatctgcaatatatttgaaccagaggtaatt
tgcattggcggaggagttagcaaagaaggagagtatcttttagaacctgtgagaaagctt
gtgtatgaaaaattctactgcaaacaggttccaatgcccaaaatcattcctgccgttttg
ggaaatgatgctggtataattggggctgcgcttttagcaaagcagctgtga

DBGET integrated database retrieval system