KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2205Help
Entry
Calkro_2205       CDS       T01357                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkro_2205
  Amino acid metabolism
   00300 Lysine biosynthesis
    Calkro_2205
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Calkro_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2408968..2410359)
Genome map
AA seq 463 aa AA seqDB search
MNDVKVMINKEIENLKDEIVNTTLKLIKIRSVEDTPAPNMPFGKGINDALLVCENLCKSL
GFETKNYDGYALEAVYGNQDEDVCVIGHLDVVPEGEGWSVPPYEGVVKDGKIFGRGAIDD
KGPTVAALYGMYVVKKLAQEGKISLKRKLRFVFGTNEEGGSKCLQYYFERAKYPTVGFTP
DADFPVIQGEKGFLVFELTKDVEDTFEIEGGHRPNMVPDRCRFEGSFDVQKAKEIISIKG
LNDKAEVFEEAGKTCIITKGVSAHGSLPFKGENAISYMFDILNDLWTKEDEFRRFIDFYN
NHIGFDVFGEKLSIGFEDEKSGKLVLNVGMIRKEKGRLVLTINVRYPVDTSYEEIENKVK
EVLQDYNIEYRLVTNVPPLYFEADHFLIRTLLKVYREFTNDDTQPLVIGGGTYARWAKNV
VAFGPNMPGDEEVAHQKDEYILIDRLILCSKIYANAIYRLAKE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatgtaaaagtgatgataaataaagaaattgaaaatttaaaagatgaaatagtg
aatactactttaaagcttataaaaatcaggagtgttgaggatacacctgcacctaatatg
ccttttggcaagggaattaatgatgccctgcttgtatgcgaaaatctatgcaaaagcttg
ggatttgaaacaaaaaactatgatggatatgcgcttgaggcggtctatggaaatcaggat
gaagatgtgtgtgttataggtcatttagatgttgtacccgaaggggaaggatggagtgtg
ccaccttatgaaggggttgtaaaggacggtaaaatttttgggcgtggcgcgattgatgac
aaaggtccgactgttgcggctctttatggcatgtatgtggttaaaaagcttgcccaggaa
gggaagatttctcttaaaagaaagctaaggtttgtttttggtacaaacgaagagggtggc
tctaagtgtcttcagtattattttgaaagagcaaaatatccaactgttggatttactcca
gatgctgattttcctgtcattcaaggtgaaaaaggttttctggtgtttgagcttacaaaa
gatgtggaagatacctttgagattgaaggaggacatcgacctaacatggtgcctgacagg
tgcaggttcgaaggcagttttgatgtccaaaaagctaaagaaattattagtataaaaggg
ctgaatgataaggcagaagtttttgaagaagctggtaagacatgtataattacaaaggga
gtttctgctcatgggagtctgcctttcaaaggtgaaaatgcaatatcgtatatgtttgat
attttaaatgatctttggacaaaagaggatgagtttagaagatttattgacttttataat
aatcatattggatttgatgtgtttggagaaaaactttcaatagggtttgaagatgaaaag
tcaggcaagcttgtgttaaatgtcgggatgatacggaaagaaaaaggcagacttgtcctt
acaataaatgttcgctatccagttgacacctcatatgaggagatagaaaataaagtaaag
gaagtgctgcaggattataatattgaatatcgtttggtgacaaacgttccccctctttat
tttgaagctgaccactttttaatcagaaccttgcttaaggtctacagagaatttacaaat
gacgatacacagccgcttgtgattggcggtggaacatacgcaaggtgggcaaaaaatgtg
gttgcttttggtccaaatatgccgggtgatgaagaagttgcccatcagaaagatgaatat
atccttatagataggctaatcctttgcagcaaaatctatgcaaatgctatttacaggctt
gcaaaagaatag

DBGET integrated database retrieval system