KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2366Help
Entry
Calkro_2366       CDS       T01357                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580056..2580529)
Genome map
AA seq 157 aa AA seqDB search
MDKHIVFLGLGSNLGNRHENIQKAIEHLKEKIIVEKISSIIETQPYGFVDQPKFLNCVLK
GTTMLLPFELLEFVLEIENKMGRKRIFKWGPRNIDIDILFYDDCVIDTVNLKIPHPELHK
RLFVLEPLCEIEKDFVHPVLKKSVYELYTQLTSPRKE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggataaacatattgtttttttagggcttggaagtaatcttggtaacagacatgagaat
atacaaaaagcaattgaacatttaaaagaaaagataatagttgaaaagatttcaagcata
attgaaacccagccttatggatttgttgaccagccaaagtttttaaactgtgttttgaaa
ggcacaaccatgcttttgccgtttgaacttcttgagtttgtacttgagatagaaaataaa
atgggtagaaaaaggatttttaaatgggggccaaggaacatcgatattgacattcttttt
tatgatgactgtgttatagacacagtaaatcttaaaatcccccatccagaacttcacaaa
agactatttgtacttgaacctctttgcgagattgaaaaagattttgtacatcctgtgctg
aaaaaaagtgtgtatgaactttacacccagcttacatctccaagaaaggaatga

DBGET integrated database retrieval system