KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2368Help
Entry
Calkro_2368       CDS       T01357                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580776..2581906)
Genome map
AA seq 376 aa AA seqDB search
MRLISKDANIKKILYQKGFDEKEILEFEKKANSIILRFDNIKNPSEFIQFLSNLGYFTIS
NENICFATTSLYNFEKTRCVLTEEGIECNFDADFTISQRYLLAKDKKLSLLKTNVMGIIN
VTPDSFYEGSRVQVEKVTQRALQMIQDGADVLDIGGESTRPFSEPVEEEEELKRVIPAIE
AIRDMDKSIPISIDTYKSRVAQKAIEAGADIINDISGGTFDKDMFYVAAHYNVPIIIMHI
KGTPKDMQKNPYYEDVIEEILQFFELRIEQALKAGVKLENIILDPGIGFGKRPEDNLEIL
RRCEEFRVLGRPILIGASRKSVIGHVLSNLPPEERLEGTLAISVICAQKKIEFVRVHDVK
ENKRAILMTQAIFDGV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgagactgatatcaaaagatgcgaatataaagaagattttgtatcaaaaaggttttgat
gagaaagaaattttggaatttgaaaaaaaggcaaactcaataattttgagatttgataac
ataaaaaatccttcagaatttattcagtttctttcaaatcttggttattttacaatttca
aacgaaaatatatgctttgcaacaacatcactttacaactttgaaaagacaagatgcgtt
ttgacagaggaagggatagagtgtaattttgatgcagattttaccatttcacaaaggtat
ttgcttgcaaaagataaaaaattgagccttttgaagacaaacgtgatggggattataaat
gtcacaccagactcgttttatgagggctcaagagttcaagttgaaaaggtaacccaaaga
gcactccagatgattcaagatggtgcagatgttctggacattggcggtgagtccacaaga
cctttttcagaaccagttgaggaagaggaagagctaaaaagagtaattcctgcaattgaa
gcgataagagatatggataaaagtatcccaatttcaattgatacatataaaagcagagta
gctcaaaaagcaatagaggccggtgctgacattataaatgatatcagtggcggaacgttt
gacaaagacatgttttacgtggcagcgcactacaatgttcctatcataatcatgcacatc
aagggtacgcctaaggatatgcaaaaaaacccttactatgaagatgttatagaagagatt
ttgcagttttttgaactgaggattgaacaggctctgaaagccggtgtaaaacttgaaaac
atcatcttagaccctggcattggctttgggaaaagaccagaggataacttggagatactg
cgaaggtgtgaagagttcagggttttaggaagacccattttgattggggcatcaagaaaa
tcggtgattggccatgtgctgagtaatcttccccctgaggaaaggcttgaaggaactttg
gcaatctctgtaatatgtgctcagaaaaagattgaatttgtaagggtgcatgatgtaaaa
gaaaacaaaagagccatcttgatgacacaggctatcttcgatggagtttaa

DBGET integrated database retrieval system