KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2385Help
Entry
Calkro_2385       CDS       T01357                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598862..2599875)
Genome map
AA seq 337 aa AA seqDB search
MSEDYYEKSTVSLAEKYKDFFKVGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHP
KEDFYNFEAADKIKNFALKHNMQLRGHTLVWHNQTPEWVFCDNDKEAPKELVIERLREHI
KTVCTRYRDVVYAWDVVNEAVEDKTDALLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLF
YNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIEIYASLG
LEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYNDVFRVFREYRDVITSVTLWGIS
DGHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagattattatgaaaaatctactgtatcacttgcggaaaaatataaagacttc
tttaaagttggtgcagctgttacagtgaaagattttgaaggaatacacggaagaattctt
acaaagcattttaacagtttaacacctgagaatgatatgaaatttgaacgaattcatccg
aaagaagatttttacaactttgaagctgctgataagattaaaaattttgcacttaaacat
aatatgcaactgagaggacatacacttgtatggcacaaccaaacacctgaatgggttttt
tgtgacaatgacaaagaagcaccaaaagagcttgtaatagaaagactgagggaacacata
aagacagtttgtacaagataccgtgatgtggtttatgcgtgggatgttgtgaatgaagct
gttgaggataaaacagatgctctgctcagagattcaaagtggagaagaatcattggtgat
gattatattaagattgcctttgaaatagctaaaaagtatacaggaaatgggaaactattt
tataacgactataacaatgaaatgccatacaaattagaaaagacatacaaggtcttaaaa
agtcttttagaagagggaactccgattgatggtgttggcatacaagcacactggaatatt
tgggataagaatttaatagacaaccttaagagagctatcgaaatatatgcatccttgggg
cttgaaatacaaataacagagcttgatatatcagtatttgaatttgaggacagaagaact
gacctattagagcccactgaagagatggtggagttgcaagctaaggtttataatgatgtg
tttagagtatttagggagtatagagatgttataacttcagttacattatgggggattagc
gatggacatacatggaaagacaattttccggtaatcggcagaaaagactggccattgctg
tttgacattgatggaaagccaaaaaaggcattttttagaataattgacttttga

DBGET integrated database retrieval system