KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2546Help
Entry
Calkro_2546       CDS       T01357                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calkro_2546
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calkro_2546
DNA repair and recombination proteins [BR:ckn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Calkro_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 PIF1 Helicase_RecD AAA_24 UvrD_C DEAD UvrD-helicase T2SSE AAA_12 HHH_2 AAA DUF2075 ATPase_2 AAA_23 AAA_22 NTPase_1 AAA_29 DUF853 ABC_tran 5_3_exonuc ABC_ATPase PhoH ArgK AAA_16 SRP54 RsgA_GTPase AAA_25 Thymidylate_kin Mg_chelatase TrwB_AAD_bind AAA_28
Motif
Other DBs
NCBI-ProteinID: ADQ47346
UniProt: E4SHX1
Position
complement(2803663..2805888)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYKNMENNYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARILQQEPEKLL
SIRGMTPEKVERIKNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALEMGVMPDDKRRISAKILNLLTLAANNEGHTCLPENRLKQLC
IRTLDLPVEKIEEALEALSQERRIVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IDNIDRKISSFEEKNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPNNPLKCDVIVVDE
MSMVDSFLMNYLLAATKPSTRIVLVGDKDQLPSVGAGNVLKDLIKSQIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQQEILKTIIDLVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQYLNPPHPSKKEYAYKENLFRVGDKVMQVKNNYSLEY
EIVQGEEKGRVSTGIFNGDIGVVRDIDRAQGTLEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPIVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALCDFLLRGQSNMQLQVL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcagggcatggtaagtgatataatctacaagaatatggaaaataat
tatacagtgtttgagataatatgtgacgatgaggtgttcacagcagtagggatagttcca
gacattgcaattggtgaaaaggtaagcgtatacggtgagttttatgttcatccggtatat
ggtcagcaacttaaagtaagttaccttgagaagctattgccacagacaaaggatgagatt
tatctttatctttcctctggggtgataaaaggtatcggtcaaaagactgcaaaaaaaatt
gttgatacctttggggatgacacagcaaggattttgcaacaagagcctgaaaagcttttg
agtattcgcggcatgacacctgaaaaggttgagcggataaagaatatgttcgcattccag
aaatttttgaaagatatcatgtcaatcttttcacagtacgggctttcacaaaaccacgca
atgagactttttaagctttatggattttctgctctatcacttttacaggaaaatccatat
tttcttttagatgtattccctgagcttgactttaaaaaagttgacaggcttgcgcttgaa
atgggagttatgccagacgacaagagaaggatatctgcaaaaatactcaatcttttaacg
ctggcagcaaacaacgaagggcacacatgcctgccagaaaataggctcaaacagctctgt
atcagaacacttgaccttccagttgaaaaaatagaagaggcacttgaagctctttctcaa
gaaagaagaattgtgaaagatgaagttgactctcaagagatggtgtttttgtacggctac
tatgagtgtgagaggtatatagcagataaaatcctgtcaatgctaaaagaatatgatgac
attgataatatagatagaaaaatttcttcttttgaagaaaaaaacggtattgcattttcg
ccaaatcagaaaaaagctatcaaaatggcgctgacacaaggtgttagcatcataacaggc
ggtcctggaacaggaaaaactacaatcataaaatgcattattcagattttcgagggtgaa
ggcaaaaaggtttttctttgcgcgccgacgggaagggctgcaaagaggatgcaggcagca
tgtgaaagagaatcaaagacaatccatagactattagaaatgacagtattagacacacat
gttatttttcagaaaggaccaaataatcccttaaaatgcgatgttattgtggttgatgaa
atgagcatggtagacagttttcttatgaactatcttcttgctgcaacaaagccgtcaacc
agaattgtccttgttggagacaaagaccagcttccatctgttggtgcaggaaatgtctta
aaagaccttataaaaagccagattgtgccctgcactactttgacagaggtgtatcgccag
agcgaaaatagttttatagttctcaacgctcacagaataaacagaggtgagtttccacat
cttcaaaaagagagcgatttttattttattcagaaaaattctcagcaagagattttaaaa
actataattgatcttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatacaagttttgtgcccttccaaaaagggaattgtgggaatgtacaatctaaaccgc
gtgctacagcagtatctcaacccgcctcatccatctaagaaggagtatgcttacaaagaa
aacttgttcagggttggggacaaagtcatgcaggtgaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcagggtctcaacagggatattcaacggcgacatt
ggagttgtaagggatatcgacagggctcaaggtactttggagattttgtttgacgatgaa
aagcttgtatattatgacttttcgctgcttgacgacttagagcttgcgtatgccatgact
gttcacaaatctcaagggtctgagtttaggtgcatagtgatgcccattgttgagacctac
cccattttgatgacaagaaacctcctttacacagctgttacacgagcaaaagaacttgtt
gtgctggtgggtaaaaaaagcgctttagagtacatgatagcaaaccagaaagaggctatg
cgatattcagcgctttgcgactttttattgcgcgggcaatcaaatatgcaattgcaagtt
ttatga

DBGET integrated database retrieval system