KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2546Help
Entry
Calkro_2546       CDS       T01357                                 

Definition
helicase, recd/traa family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calkro_2546
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calkro_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2803663..2805888)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYKNMENNYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARILQQEPEKLL
SIRGMTPEKVERIKNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALEMGVMPDDKRRISAKILNLLTLAANNEGHTCLPENRLKQLC
IRTLDLPVEKIEEALEALSQERRIVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IDNIDRKISSFEEKNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPNNPLKCDVIVVDE
MSMVDSFLMNYLLAATKPSTRIVLVGDKDQLPSVGAGNVLKDLIKSQIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQQEILKTIIDLVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQYLNPPHPSKKEYAYKENLFRVGDKVMQVKNNYSLEY
EIVQGEEKGRVSTGIFNGDIGVVRDIDRAQGTLEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPIVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALCDFLLRGQSNMQLQVL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcagggcatggtaagtgatataatctacaagaatatggaaaataat
tatacagtgtttgagataatatgtgacgatgaggtgttcacagcagtagggatagttcca
gacattgcaattggtgaaaaggtaagcgtatacggtgagttttatgttcatccggtatat
ggtcagcaacttaaagtaagttaccttgagaagctattgccacagacaaaggatgagatt
tatctttatctttcctctggggtgataaaaggtatcggtcaaaagactgcaaaaaaaatt
gttgatacctttggggatgacacagcaaggattttgcaacaagagcctgaaaagcttttg
agtattcgcggcatgacacctgaaaaggttgagcggataaagaatatgttcgcattccag
aaatttttgaaagatatcatgtcaatcttttcacagtacgggctttcacaaaaccacgca
atgagactttttaagctttatggattttctgctctatcacttttacaggaaaatccatat
tttcttttagatgtattccctgagcttgactttaaaaaagttgacaggcttgcgcttgaa
atgggagttatgccagacgacaagagaaggatatctgcaaaaatactcaatcttttaacg
ctggcagcaaacaacgaagggcacacatgcctgccagaaaataggctcaaacagctctgt
atcagaacacttgaccttccagttgaaaaaatagaagaggcacttgaagctctttctcaa
gaaagaagaattgtgaaagatgaagttgactctcaagagatggtgtttttgtacggctac
tatgagtgtgagaggtatatagcagataaaatcctgtcaatgctaaaagaatatgatgac
attgataatatagatagaaaaatttcttcttttgaagaaaaaaacggtattgcattttcg
ccaaatcagaaaaaagctatcaaaatggcgctgacacaaggtgttagcatcataacaggc
ggtcctggaacaggaaaaactacaatcataaaatgcattattcagattttcgagggtgaa
ggcaaaaaggtttttctttgcgcgccgacgggaagggctgcaaagaggatgcaggcagca
tgtgaaagagaatcaaagacaatccatagactattagaaatgacagtattagacacacat
gttatttttcagaaaggaccaaataatcccttaaaatgcgatgttattgtggttgatgaa
atgagcatggtagacagttttcttatgaactatcttcttgctgcaacaaagccgtcaacc
agaattgtccttgttggagacaaagaccagcttccatctgttggtgcaggaaatgtctta
aaagaccttataaaaagccagattgtgccctgcactactttgacagaggtgtatcgccag
agcgaaaatagttttatagttctcaacgctcacagaataaacagaggtgagtttccacat
cttcaaaaagagagcgatttttattttattcagaaaaattctcagcaagagattttaaaa
actataattgatcttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatacaagttttgtgcccttccaaaaagggaattgtgggaatgtacaatctaaaccgc
gtgctacagcagtatctcaacccgcctcatccatctaagaaggagtatgcttacaaagaa
aacttgttcagggttggggacaaagtcatgcaggtgaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcagggtctcaacagggatattcaacggcgacatt
ggagttgtaagggatatcgacagggctcaaggtactttggagattttgtttgacgatgaa
aagcttgtatattatgacttttcgctgcttgacgacttagagcttgcgtatgccatgact
gttcacaaatctcaagggtctgagtttaggtgcatagtgatgcccattgttgagacctac
cccattttgatgacaagaaacctcctttacacagctgttacacgagcaaaagaacttgtt
gtgctggtgggtaaaaaaagcgctttagagtacatgatagcaaaccagaaagaggctatg
cgatattcagcgctttgcgactttttattgcgcgggcaatcaaatatgcaattgcaagtt
ttatga

DBGET integrated database retrieval system