KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2574Help
Entry
Calkro_2574       CDS       T01357                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Calkro_2574
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Calkro_2574
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Calkro_2574
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Calkro_2574
Exosome [BR:ckn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calkro_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2829862..2831505
Genome map
AA seq 547 aa AA seqDB search
MKNVFLRRKNILISAILILCIILSTLAFAQQDINDNENKVKNVILMIPDGMTIAHTTLAR
WYQGGEPLAMDELACGLVRTYSANNPITDSAPAATAYATGFKTQNRYLSIYPEMVSMPGV
GQVEEKDFYKPIITILESAKRLGKSTGLVFTCQFPHATPAAFASHTDNRNDYESIAEQMV
YNHVDVVLGGGYKYIDKNQRKDKEDLAGYLKQNGIFVTTNWQDAKNFFGQKIWGLFAQDA
MHYDFDRKDAGEPSLAEMTQKAIQILSKNRNGFFLMIEGSQIDWASHANDPVGVVSEVLA
FDKAVKVALDFAKSRDDTAIIIVPDHTNGGMTLGIGTTSIDSVLLNHFLKYIRRATRTAA
GVEEILGNNKTDENIKKVVSQYYGIDNLTQDEINAIKNAPQGRLNYVLGPIISKRSYIGW
TSNEHTGEEVVLYAYHPKDYIPRGVIENTEVCDYMAEILGIDLGSFNENAYISNIDLEEK
GYNVSIDTSNPSNIQLVINKGSKKYIIPQNKNLVLEGSNQYKLKYVSVYIPSAKRFFVSS
EIESLIK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttttttgagaagaaaaaatatacttatttcagcaattttaatcctatgt
ataattttatcaactcttgcatttgctcaacaagatataaatgataatgaaaataaagtc
aaaaatgttattttaatgattcctgatggtatgacaatagctcacacaacacttgctcgc
tggtatcaaggtggagaacctttggcaatggacgaacttgcctgtgggcttgtaagaaca
tattcagcaaacaatccaattacagactcagcaccagctgcaacagcttatgcaacaggg
tttaaaacccaaaacaggtacctttccatatatcctgagatggtttcaatgccaggagtt
gggcaagtagaggaaaaagatttttataagccaataataactatattggaatcagctaaa
aggttaggaaaatcaacaggtcttgttttcacatgccagtttccgcacgcaacacctgct
gcttttgcctcacatacagataacagaaatgattatgaatctatagccgagcagatggtt
tataaccatgttgatgttgtgctcggtggagggtacaaatacattgacaaaaatcagaga
aaagacaaagaagatttggcaggctacttgaagcaaaatggcatttttgttacaacaaac
tggcaggatgcaaagaactttttcggtcagaaaatctggggactctttgcccaagatgca
atgcactatgattttgacaggaaagatgcaggtgagccatccttagcagagatgacccaa
aaagccattcagattctgtccaaaaatagaaatggttttttcttgatgatagagggaagc
cagattgactgggcatctcatgcaaacgaccctgttggagttgtatcagaggttttggca
tttgacaaggctgtcaaagtagctttagactttgctaagtcaagagatgatacagctata
attattgtaccagaccataccaatggtggtatgacacttggaataggaacaacttcaatt
gacagtgtactattgaatcattttctgaagtacatcagaagagcaacaagaacagcagca
ggagtagaagaaatacttggaaacaataaaacagatgaaaatatcaaaaaggtagtatca
cagtattatggcattgacaatcttacacaggatgagataaatgcaatcaaaaacgctcct
cagggaaggttaaactatgtattaggaccaattataagcaagcgatcatacattggttgg
acttcaaatgaacacacaggtgaagaggttgttttatatgcatatcacccaaaagattac
attccaagaggtgttattgaaaacacagaggtctgtgactacatggcagaaattcttggt
attgaccttggaagctttaatgaaaatgcatatatctcaaacattgacttagaagaaaaa
ggatataatgtttccattgacacaagtaacccgtcaaatattcagcttgtaataaacaaa
ggaagcaaaaagtacatcatcccgcaaaacaaaaatttggttttagaaggttctaatcag
tataagttaaaatatgtaagtgtgtacattccaagtgcgaaaaggttctttgtgtcaagt
gagatagaaagtttgattaaatga

DBGET integrated database retrieval system