KEGG   Citrobacter koseri: CKO_00146Help
Entry
CKO_00146         CDS       T00592                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cko  Citrobacter koseri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKO_00146 (hemD)
Enzymes [BR:cko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKO_00146 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(139452..140192)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPSGEELVSRLRTLGQVAWSFPLIEFTPGRELATLADRLAALTDNDLVFALS
QHAVAFAHAQLQQQGLDWPVQPRYFAIGRTTALALHTVSGCDIRYPLDREISEVLLQLPE
LQNIAGKRALILRGNGGRELLGKTLTERGAEVTFCECYQRSAKHYDGAEEAMRWHSRGVT
TIVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctggtcacccgcccgtctccctccggggaagagttagtgagccgtctgcgc
acactggggcaggtggcctggagttttccgcttattgagtttacgccaggccgggaactg
gcaacgcttgccgatcgcctggcggcgctcacggacaacgatctggtgttcgccctctcg
caacacgccgtcgcctttgcccacgcccaactgcaacagcaggggcttgactggcctgtg
caaccacgctacttcgccatcgggcgcacaacggcgctggcgctgcataccgttagcgga
tgcgatattcgctaccctctggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggaaaacgagcgcttattttacggggcaacggcgggcgtgaactg
ttaggcaaaaccctcacagaacgcggcgctgaagtcaccttttgtgaatgttatcaacgc
agtgcaaaacattacgatggcgcggaagaggcgatgcgctggcactctcgcggcgtgacg
acgattgttgtcaccagcggcgaaatgctgcaacagctctggtcgctgatcccgcagtgg
tatcgtgagcactggttactacgctgtcggctgctggtcgtcagtgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctactgcgcgcattacaataa

DBGET integrated database retrieval system