KEGG   Citrobacter koseri: CKO_00188Help
Entry
CKO_00188         CDS       T00592                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
cko  Citrobacter koseri
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_00188 (fadB)
   01212 Fatty acid metabolism
    CKO_00188 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CKO_00188 (fadB)
   00650 Butanoate metabolism
    CKO_00188 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    CKO_00188 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    CKO_00188 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKO_00188 (fadB)
   00310 Lysine degradation
    CKO_00188 (fadB)
   00380 Tryptophan metabolism
    CKO_00188 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKO_00188 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKO_00188 (fadB)
   00281 Geraniol degradation
    CKO_00188 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CKO_00188 (fadB)
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CKO_00188 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKO_00188 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CKO_00188 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     CKO_00188 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177009..179198)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQTDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAINGYALGGGCEC
VLATDYRLVTPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDIGAEQALK
IGLVDGVVKPEKLLDGAIAVLRQAIDGSLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMIAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQFVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAAKLL
NKQLERGRIDGLKLAGVISTIHPTLNYAGFDRVDVVVEAVVENPKVKKAVLAETEDNVRP
DTVLASNTSTIPISELASALKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRYGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLAEVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggatcggtcaataaactcgacactgcgaccgtcgccagcctcggc
caggcgctggacgtgctggaaaagcaaacagatttaaaagggctgctgctgcgctctaac
aaagcagcctttattgtcggtgctgatatcaccgaattcctttcgctgttccttgttcct
gaagaacagttaagccagtggctgcattttgccaacagcgtctttaatcgcctcgaagat
ttaccggtgccaacgctttccgccatcaacggctatgcgctgggcggcggctgcgagtgc
gtactggcgaccgattatcgtctggtgacgccggatctgcgcattggcctgccggaaacg
aagctgggcatcatgccgggctttggcggttctgtccgtatgccgcgtatgctgggcgct
gacagcgcgctggaaattattgctgccgggaaagacattggcgctgagcaggcgctgaaa
atcggcctggtcgacggtgtcgtgaaaccggaaaaactgcttgatggcgcaatagcggta
ttacgtcaggcgattgacggctcactggactggaaagccaaacgccagccgaagctggaa
ccgttgaagctcagtaaaattgaagcggcgatgagctttaccatcgccaaaggcatggtg
gcgcagacggccgggaagcattaccccgccccgatgatcgccgtgaaaacgatcgaagcc
gccgcacgctttggccgtgaagaagccctgaatctggaaaataaaagctttgtcccgctg
gcgcataccaatgaagcccgcgcgctggtcggtatcttcctcaacgatcagttcgtgaaa
ggtaaagcgaaaaagctgaccaaagacgttgaaacaccgaagcaggcagccgtactgggc
gcaggtattatgggcggcggtatcgcttaccagtcagcctggaaaggcgtgccggtgatc
atgaaagatatcaacgacaaatccctgacgctgggcatgaccgaagcggcgaaactgctg
aataagcagctggaacgcggcaggatcgacggcctgaaactggcgggcgtgatttcaacg
attcacccaacgctgaactacgccggttttgatcgcgttgatgtagtggtcgaagcggta
gtggaaaacccgaaagtgaagaaagcggtactggcggagactgaagacaacgtccgcccg
gataccgtgctggcgtcaaatacgtccaccattccaattagtgaactggcaagcgcgctg
aagcgcccggaaaacttctgcggcatgcacttctttaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaaaagctcggatgaaaccatcgctaaagtcgtcgcctgg
gccagcaaaatgggcaaaacgccgattgtggtcaacgactgccccggcttctttgttaac
cgcgtactgttcccgtatttcgccggtttcagccagctactgcgcgacggcgccgatttc
cgcaaagtcgacaaagtgatggagaaacagtttggctggccgatgggcccggcttatctg
ctggatgtggtcgggatcgataccgcgcatcatgcacaggcagtcatggcggccggtttc
ccacagcgtatgcagaaagattatcgtgatgccatcgacgcgctgtttgacgccagccgc
tatggtcagaaaaacggtctgggtttctggcgctataaagaagacagcaaaggcaagccg
aagaaagaagaagacgcagccgtggacagcctgctggcagaggtcagccagccgaaacgc
gacttcagcgacgaagagattatcgcccgcatgatgattccgatggtcaacgaagtggtg
cgctgtctggaagaaggcatcatcgccagtccggcagaagcggatatggcgctggtttac
ggtctgggcttccctccgttccacggcggcgcgttccgctggctggatacgctcggcagc
gcaaaatatctcgatatggcgcagcagtatcagcacctcggcccactctatgaagtgccg
gaaggtctgcgtaacaaagcgcgccataacgaaccgtactatcccccggttgagccagcc
cgcccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system