KEGG   Citrobacter koseri: CKO_00412Help
Entry
CKO_00412         CDS       T00592                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_00412 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_00412 (glk)
   00052 Galactose metabolism
    CKO_00412 (glk)
   00500 Starch and sucrose metabolism
    CKO_00412 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CKO_00412 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CKO_00412 (glk)
   00524 Butirosin and neomycin biosynthesis
    CKO_00412 (glk)
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CKO_00412 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387729..388694
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDMTSGEISQAKTYSGLDYPSLEAVVRVYLDEHNARVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLRKEHLIQFG
GAEPVAGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDITERALADTCIDSRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatatgctttagtaggtgatgtaggcggcaccaacgcgcgtcttgctctgtgc
gatatgaccagcggggagatttcgcaggcgaaaacctattccgggctggactatccgagc
ctcgaagccgtggttcgcgtgtatctggacgagcataacgccagggtggaagatggctgt
atcgctatcgcctgcccgatcaccggtgactgggtggcgatgactaaccacacctgggca
ttttctattgcggagatgaaaaagaatcttggctttagccatctggaaatcatcaacgat
tttaccgccgtgtcgatggcgatcccgatgctgcgcaaagagcatctgatccagttcggc
ggcgcggaaccggttgccggcaaaccgattgccgtttacggcgccggaaccggattaggg
gtggcacacctggttcatgtcgataaacgctggatcagcctgccgggcgagggtggtcac
gttgacttcgcgccgaacagcgaagaggaaggcattattctcgaagaactgcgtgcggaa
attggtcacgtctctgccgagcgcgtgttgtcggggccagggctggtgaatctgtatcgt
gctatcgtcaaatctgatggccgtctgccggaaaatctgcaaccgaaagatattaccgaa
cgcgcgctggcggatacctgcattgactctcgtcgtgcgctgtcgctgttttgcgtcatt
atgggccgttttggcggtaatctggcattgacgctgggcacgtttggcggcgtctacatt
gcgggcggcatcgtgccgcgcttcctggagttctttaaagcctccggctttcgtggcggg
tttgaagacaaaggccgtttcaaagcctacgttcaggatattccggtttacctgattgtg
catgataatcccggtctgctcggctccggcgcgcatttgcgccagacgttagggcaaatt
ctgtaa

DBGET integrated database retrieval system