KEGG   Citrobacter koseri: CKO_00449Help
Entry
CKO_00449         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cko  Citrobacter koseri
Pathway
cko00071  Fatty acid degradation
cko00280  Valine, leucine and isoleucine degradation
cko00281  Geraniol degradation
cko00310  Lysine degradation
cko00362  Benzoate degradation
cko00380  Tryptophan metabolism
cko00410  beta-Alanine metabolism
cko00640  Propanoate metabolism
cko00650  Butanoate metabolism
cko00903  Limonene and pinene degradation
cko00930  Caprolactam degradation
cko01040  Biosynthesis of unsaturated fatty acids
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
cko01212  Fatty acid metabolism
Module
cko_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CKO_00449
   00650 Butanoate metabolism
    CKO_00449
  Lipid metabolism
   00071 Fatty acid degradation
    CKO_00449
   01040 Biosynthesis of unsaturated fatty acids
    CKO_00449
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKO_00449
   00310 Lysine degradation
    CKO_00449
   00380 Tryptophan metabolism
    CKO_00449
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKO_00449
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKO_00449
   00281 Geraniol degradation
    CKO_00449
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKO_00449
   00930 Caprolactam degradation
    CKO_00449
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CKO_00449
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKO_00449
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CKO_00449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABV11605
UniProt: A8ADP2
Position
432669..434816
Genome map
AA seq 715 aa AA seqDB search
MDMTSAFTLNVRLDNVAVVSIDVPGEKMNTLKAEFATQVRAILKQIRENKALRGVVFISA
KPDNFIAGADINMIGNCKSAQEAETLARQGQQIMAEIQALSVPVVAAIHGACLGGGLEMA
LACHRRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRPKQAL
RVGLVDEVVPHAILLEAAVELAIKGRSAQRNLPVRERILAGPLGRTLLFRMVSKKTGQKT
QGNYPATERILEVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAQPGPLASVGVLGGGLMGGGIAYVTACKGGLSVRIKDINAKGINHALKYSWDQLETKV
RRRHIKAGERDKQLALISGSTDYRGFSHRDLVIEAVFEDLALKQQMVAEVEQNCAPHTIF
ASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHATTSAQTIATTVKLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRLLTEGERVEAIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGVKGRKSKKQVDPA
IYRLIGTQGQSRLSAQQMAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAVLQRLATQYGDRFTPCERLLRMAERGERFWNSGETDLKE
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacatcagcgttcacgcttaacgtgcgtctggataacgtcgcggtcgtctct
attgatgtccccggtgagaaaatgaataccctgaaggcggagttcgcgacgcaggttcgc
gccatcctgaaacagattcgggaaaacaaggcgctgcgcggtgtggtttttatttctgcg
aagccggataactttatcgcgggggcggatatcaacatgatcggcaactgcaaaagcgcg
caggaagctgaaacgctggcgcgtcagggccagcagataatggctgaaattcaggcgctg
tctgttccggttgtcgccgccattcacggcgcgtgtctcggcggtgggttagagatggcg
ctggcttgccatcggcgcatttgtactgatgatgcgaaaaccgtgctgggtctgccggaa
gtgcaactggggctgctgccagggtctggcggtacgcagcgattaccgcgcctggttggg
gtgagtacggcgctggacatgatcctcaccggtaagcagttacggccaaaacaagcgctc
agggttggtctggtggacgaagtcgtgccgcacgccattttgcttgaggccgccgtggaa
ctggcgattaaagggcgttccgctcagcggaatttgccggtgcgtgaacgtattctggcc
gggccgcttgggcgcacgctgctgtttcgcatggtcagtaaaaaaaccgggcagaaaacg
cagggtaattacccggcgacagagcgaatccttgaggtgattgaaaccgggctggcgcag
ggaagcagtagcggatacgacgcggaagcgcgggcgtttggcgaactggcgatgacgcca
cagtcgcaggcgttgcggaatatcttttttgccagtaccgaagtgaaaaaagatccgggg
agcgatgcgcagcctggcccgttagccagcgtaggcgtgctgggcggaggtctgatgggc
ggcggtattgcttacgtgacggcctgtaaaggcggcttgtcggttcgcatcaaagatatt
aatgccaaaggcatcaaccacgcgctgaagtacagctgggatcagcttgaaaccaaagtt
cgccgccgccatatcaaagcgggcgaacgcgacaaacagctggcgctaatctccggctca
acggattaccgcggcttctcgcatcgggatctggttattgaagcggtgtttgaagatctg
gcgttaaaacagcagatggtggcggaagtcgagcaaaactgcgctcctcacaccattttt
gcctccaacacctcatctttacccatcggcgacatcgcggctaacgcggccaggcctgag
caggtgattggtttgcacttctttagcccggtagaaaaaatgccgttggtggaggtcatt
cctcatgcgacaacctctgcgcagacgatcgccacgaccgttaagctggcgaaaaaacag
ggcaaaacgccgattgtggtcagcgataaagccgggttctacgttaatcgtattcttgcc
ccgtatatcaacgaagcaatacggttgctgaccgaaggcgaacgcgttgaagcgatcgac
gccgcgctggtcaagtttggttttccggtcgggccaatccaacttttggatgaggttggc
atcgatacaggcactaaaattatacctgtactggaagccgcttacggcgaacgttttagc
gcgcctgcaaacgttgttgcctcaattttgaatgacgatcgcaaaggcagaaaaaatggt
cgcggtttctatctttatggcgtgaaagggcgtaaaagcaaaaaacaggtcgaccctgca
atttataggcttattggtacgcaagggcagagccgactttctgcgcagcaaatggctgag
cggtgcgtgatgttaatgctcaatgaagcggcgcgctgctttgatgagaaggtgatccgc
agcgcgcgtgatggcgacatcggtgcggtatttggtattggttttccgccgtttcttggc
ggcccgttccgttatatggacactctcggcgcgggtgaagtggttgcggttctgcaacga
ctggctacgcagtatggcgaccggtttaccccgtgcgagcgcttattgcggatggctgaa
cgcggtgaacgtttctggaacagtggggaaacagacctgaaggaataa

DBGET integrated database retrieval system