KEGG   Citrobacter koseri ATCC BAA-895: CKO_00944Help
Entry
CKO_00944         CDS       T00592                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cko00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942641..943498
Genome map
AA seq 285 aa AA seqDB search
MPGVFRLSVDMLLHDAAQFVQAGIPAIALFPCIESSAKSLMADASWDPSGLVPRAVRALK
KAFPELGVITDVALDAYTTHGQDGITDENGYVLNEPTKEILTRQALTHAEAGADIVAPSD
MMDGRIGHIRQAFETNGLLNIQIMAYSAKYASNYYGPFREATKSAVSLGKRDKKSYQMDP
ANAMEAMHEIAQDLQEGADMVMVKPGMPYLDIIREARKTFAVPVFAYQVSGEYTMHMAAF
RNGWLDEEKTVLESLMCFKRAGADGILTYFANTVAQLLNQHKREY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgtatttcgtctgtcggttgatatgttgcttcatgatgccgcgcaatttgtt
caggcaggtatacctgctattgcactatttccgtgtatagaaagttctgctaaatcgctg
atggcagacgcttcgtgggatccatccggtttagtaccgcgagctgtaagggcgctgaaa
aaggcttttcctgaactcggggtgataactgacgttgctcttgacgcctatacgacacat
ggtcaggacggcatcactgacgaaaatggatatgtacttaatgagccgacaaaagaaatt
ctcaccagacaggcgcttacccacgccgaagcaggcgcagatattgtcgctccaagcgac
atgatggatggccgcatcggtcatatcagacaagcgtttgaaacgaatggactgcttaat
atccagataatggcgtattcagcaaaatacgcgtcgaactattatggtccttttcgcgag
gcgacgaaatctgctgtatcactgggtaaacgggacaaaaaaagctatcagatggatccg
gcgaatgcaatggaagctatgcatgaaattgcccaggatttgcaggaaggggcagacatg
gtgatggttaagccgggcatgccttacctggatattatcagggaagccaggaaaactttt
gcagtacccgtctttgcctatcaggtttcaggggaatatacgatgcatatggccgctttc
cgaaatggttggctggacgaagaaaaaacggtgcttgaatcacttatgtgcttcaaacgc
gccggggcggatggaatactgacttattttgccaatacagtagcccagttgcttaatcaa
cataaacgggaatattga

DBGET integrated database retrieval system