KEGG   Citrobacter koseri: CKO_01069Help
Entry
CKO_01069         CDS       T00592                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cko  Citrobacter koseri
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cko00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CKO_01069
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CKO_01069
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CKO_01069
Two-component system [BR:cko02022]
 CheA family
  CheA-CheYBV
   CKO_01069
Bacterial motility proteins [BR:cko02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CKO_01069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1048958..1050007
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKYNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTASRARLAAHKPMAAPVTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELTRSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtgttgtcggttgacgattcagcgctgatgcgccaaatcatgacc
gaaattattaacagccatagcgatatggaaatggtggcgacggcgcccgatccgctggtt
gccagggatttaatcaaaaaatataaccccgatgtgctgacgctggatgtggaaatgccg
cgcatggacggtctcgattttcttgagaaactgatgcgcctgcgtccgatgccggtggtt
atggtctcctctctgaccgggaaaggttcagaggtgacactgcgtgcgctggaactgggg
gcgattgattttgtcaccaagcctcagttgggcattcgcgaggggatgctggcgtacagc
gagatgatcgcagagaaagtccgcaccgcgtcacgcgctcgcctggcggcgcataagccg
atggctgcgcctgtgacgctaaaagcggggccgctgctcagttctgaaaaactgatcgcg
attggtgcctcgacggggggaaccgaggccatacgtcatgtgctgcaaccgctgccgctt
tccagtccggcggtgatcatcacccagcatatgccgcccggttttacccgttcgtttgcc
gagcggttaaataagctctgccagattagcgtgaaagaggcggaagacggcgaacgcgtg
ttgcctggccatgcctacatcgcccccggcgacaagcatatggaactgacgcgcagcggg
gcgaactatcaaatcaaaattcatgacgggccgccggttaaccgccatcgcccgtcagtg
gatgtgctgtttcattcggtcgcgaaacatgcggggcgcaatgcggtaggggtcatcctt
accggtatgggcaacgatggcgcggccggaatgttagcgatgcaccaggctggcgcctgg
actatcgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtgagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system