KEGG   Citrobacter koseri ATCC BAA-895: CKO_01069Help
Entry
CKO_01069         CDS       T00592                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cko02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cko02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1048958..1050007
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKYNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTASRARLAAHKPMAAPVTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELTRSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtgttgtcggttgacgattcagcgctgatgcgccaaatcatgacc
gaaattattaacagccatagcgatatggaaatggtggcgacggcgcccgatccgctggtt
gccagggatttaatcaaaaaatataaccccgatgtgctgacgctggatgtggaaatgccg
cgcatggacggtctcgattttcttgagaaactgatgcgcctgcgtccgatgccggtggtt
atggtctcctctctgaccgggaaaggttcagaggtgacactgcgtgcgctggaactgggg
gcgattgattttgtcaccaagcctcagttgggcattcgcgaggggatgctggcgtacagc
gagatgatcgcagagaaagtccgcaccgcgtcacgcgctcgcctggcggcgcataagccg
atggctgcgcctgtgacgctaaaagcggggccgctgctcagttctgaaaaactgatcgcg
attggtgcctcgacggggggaaccgaggccatacgtcatgtgctgcaaccgctgccgctt
tccagtccggcggtgatcatcacccagcatatgccgcccggttttacccgttcgtttgcc
gagcggttaaataagctctgccagattagcgtgaaagaggcggaagacggcgaacgcgtg
ttgcctggccatgcctacatcgcccccggcgacaagcatatggaactgacgcgcagcggg
gcgaactatcaaatcaaaattcatgacgggccgccggttaaccgccatcgcccgtcagtg
gatgtgctgtttcattcggtcgcgaaacatgcggggcgcaatgcggtaggggtcatcctt
accggtatgggcaacgatggcgcggccggaatgttagcgatgcaccaggctggcgcctgg
actatcgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtgagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

DBGET integrated database retrieval system