KEGG   Citrobacter koseri ATCC BAA-895: CKO_01314Help
Entry
CKO_01314         CDS       T00592                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cko00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cko00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cko00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cko00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282019..1282927
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGCSQIMVEPVEDVTAYGV
VDCKGAALAPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEDELGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtcaaaaaagccgttatcccggtcgcgggattaggaacc
aggatgttaccggcgacgaaagcgatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtatgtcgtgaatgaatgtattgctgcgggcatcactgaaattgtgctggtg
acgcactcttccaaaaactcgatcgaaaaccatttcgataccagcttcgagctggaagct
atgctggaaaaacgtgttaagcgtcagctgctggaagaggtgcaatctatttgccctccg
cacgtaacgattatgcaggtgcgtcaggggctggcgaaaggcctgggtcatgccgtattg
tgcgcgcatcctgttgttggtaatgagcccgtcgcggtgattctgccggacgttattctg
gatgaatacgaatccgatctgtctcaggataaccttgctgaaatgattcgtcgttttgac
gaaaccggctgtagccagattatggttgagcctgttgaagatgttaccgcgtacggcgtt
gttgattgcaaaggcgcggcgctggcaccgggcgaaagcgtgccgatggttggcgttgta
gagaagccgaaagcggatgtcgcgccgtctaatctcgcggtagttggccgttatgtcctg
agcgcggacatctggcctctgctggcgaaaacccctccgggagcgggcgacgaaattcag
ctgaccgacgcgattgatatgctgatcgaaaaagaaacggtcgaagcctaccatatgaag
ggcaaaagccacgactgcggtaataaattaggttacatgcaggcgttcgttgaatatggc
atccgtcataattctctgggcgctgaatttaaagcatggcttgaagacgagttgggtatt
aagaagtaa

DBGET integrated database retrieval system