KEGG   Citrobacter koseri: CKO_01318Help
Entry
CKO_01318         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cko  Citrobacter koseri
Pathway
cko00010  Glycolysis / Gluconeogenesis
cko00071  Fatty acid degradation
cko00350  Tyrosine metabolism
cko00620  Pyruvate metabolism
cko00625  Chloroalkane and chloroalkene degradation
cko00626  Naphthalene degradation
cko00650  Butanoate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_01318
   00620 Pyruvate metabolism
    CKO_01318
   00650 Butanoate metabolism
    CKO_01318
  Lipid metabolism
   00071 Fatty acid degradation
    CKO_01318
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKO_01318
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKO_01318
   00626 Naphthalene degradation
    CKO_01318
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKO_01318
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CKO_01318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ABV12455
UniProt: A8AG42
Position
complement(1284792..1287467)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYEIAELAGFTVPETTKILIGEVTAVDDSEPFAHEKLSPTLAMYRAKDFEDAVDKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESVKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFTEGEVAAKKEAAAPKADKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtgaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggttgacaaaatcttccgcgccgccgctctg
gctgccgcagatgctcgaattcccctcgctaagatggccgttgccgaatccggcatgggt
atcatcgaagataaagtgattaaaaaccacttcgcctccgaatacatctataacgcctat
aaagatgaaaaaacctgtggtgtgctgtctgaagacgacaccttcgggactatcaccatt
gctgaaccgattggtatcatctgcggtatcgtaccgaccactaacccgacgtctactgcg
atctttaagtctctgattagcctgaagacgcgtaacgcaatcatcttctctcctcatccg
cgtgccaaagatgcaacgaacaaagcggctgacatcgttttgcaggcggctatcgctgcg
ggcgcgccgaaagacctgattggctggatcgatcaaccttccgttgaactgtctaacgcg
ctgatgcaccaccctgatatcaacctgatcctggcgacaggcggtccgggcatggttaaa
gctgcatacagctctggtaaaccggctatcggcgttggtgcaggtaacacgccggttgtt
atcgacgaaacagcagatatcaaacgtgcggtggcttccgtactgatgtccaaaactttc
gataacggcgtaatctgtgcatctgaacagtccgttgttgttgttgactccgtttatgac
gcagttcgcgaacgtttcgccagccacggcggctacctgctgcaaggcaaagagctgaaa
gccgttcaggacgttatcctgaaaaatggcgcgctgaacgcggctatcgttggtcaaccg
gcatatgaaattgctgaactggcaggcttcaccgtaccagaaaccactaagattctgatc
ggcgaagtaacggctgttgatgacagcgaaccgttcgctcacgaaaagctgtctccgacg
ctggcaatgtatcgcgctaaagacttcgaagacgctgttgataaagcagaaaaactggtt
gcaatgggcggtatcggtcatacctcctgtctgtacaccgaccaggacaaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgattaacaccccggct
tctcagggtggtatcggcgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgaccgaccgtttcctgttcaacaatggctatgctgaccagatcacc
tccgtgctgaaagcggctggcgttgaaactgaagtcttctttgaagttgaagctgacccg
acgctgactatcgttcgtaaaggcgcagagctggcgaactccttcaaaccagacgtgatc
atcgcgctgggcggcggctccccgatggatgcggcgaaaatcatgtgggtcatgtacgaa
catcctgaaacccacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatggtcgcaatcactaccacttccggt
accggttctgaagtaacgccgtttgctgttgtgaccgacgatgcgaccggtcagaaatat
ccgctggcagactatgcgctgacgccggatatggcgattgtcgatgcgaacctggttatg
gacatgccgaagtctctgtgtgcgttcggtggtctggatgcggtcactcacgctctggaa
gcctacgtttccgtactggcatctgagttctctgacggtcaggctttgcaggcactgaaa
ctgctgaaagaaaacctgccagcgtcctaccacgaagggtctaaaaacccggtagcgcgt
gaacgcgttcacagtgcagcgactatcgccggtatcgcgtttgcgaacgccttcctgggt
gtgtgccactctatggcgcataaactgggttctcagttccacattccgcacggtctggca
aacgccctgctgatttgtaacgttatccgttacaacgcgaacgacaacccgaccaagcag
actgcgttcagccagtatgaccgtccgcaggctcgccgtcgctatgcagaaatcgccgac
catctgggtctgagcgcaccgggcgaccgtactgccgctaagatcgagaaactgctggca
tggctggaaagcgtgaaagcggagctgggtattcctaagtctatccgtgaagctggcgtg
caggaagctgacttcctggctcatgtagacaagctgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgttacccgctgatctccgagctgaaacagattctgctggat
acctactacggccgtgaattcactgaaggtgaagttgctgcgaagaaagaagctgccgca
ccgaaagctgacaagaaagcgaagaaatctgcttaa

DBGET integrated database retrieval system