KEGG   Citrobacter koseri ATCC BAA-895: CKO_01336Help
Entry
CKO_01336         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cko01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cko00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cko00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303410..1304216)
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLKDRKEGAFVPFVTLGDPSVEQSLNIIDTLIEAGADALELGIPFSDPLAD
GPTIQEATLRAFAAGVTPTQCFEMLALIRQKHPTIPIGLLMYANLVFSKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRYNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLVEKLQEYNAAPPLQGFGISSPEQVTGAIEAGAAGAISGSAIVKL
IEKNVANPGQMLTELKAFVTAMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgaaaacctgtttgcacagctgaaggatcgcaaggaaggcgcatttgtc
cccttcgtgaccctgggcgatccttccgttgaacagtcactgaacattattgatacgctg
attgaagccggcgccgacgcccttgaactcggcattccgttctccgatccgctggcagac
gggccgaccatccaggaagccacgctgcgcgcgtttgccgcaggcgtaacgcctacgcaa
tgctttgagatgctggcgctgattcgtcagaaacacccgacgattccgattggtctgctg
atgtacgccaacctggtattcagcaaagggatcgacgaattctacgcgcagtgcgagaaa
gtcggcgtggattccgtactggtggcggatgtgcctgttgaggagtctgcgcccttccgt
caggcggcattacgctacaacgtggcgccgattttcatctgcccgcccaatgccgatgac
gatctgttgcgccagatagcctcttatggccgcggctatacctatctgctttcgcgggca
ggcgtgacgggcgcagaaaaccgcgccgcattaccgctgcatcatctggtagaaaaactg
caagagtataacgccgcgcccccgttgcagggctttggcatctcttccccggaacaggtt
acaggtgccattgaagccggcgccgccggggcgatttccgggtcagcaatcgttaagctc
attgagaaaaacgtcgcaaaccccggccagatgctgaccgagctgaaagcgtttgtcacg
gcaatgaaagccgcgacccgcgcataa

DBGET integrated database retrieval system