KEGG   Citrobacter koseri: CKO_01336Help
Entry
CKO_01336         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cko  Citrobacter koseri
Pathway
cko00260  Glycine, serine and threonine metabolism
cko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01130  Biosynthesis of antibiotics
cko01230  Biosynthesis of amino acids
Module
cko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKO_01336
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKO_01336
Enzymes [BR:cko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKO_01336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE DUF4332
Motif
Other DBs
NCBI-ProteinID: ABV12473
UniProt: A8AG60
Position
complement(1303410..1304216)
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLKDRKEGAFVPFVTLGDPSVEQSLNIIDTLIEAGADALELGIPFSDPLAD
GPTIQEATLRAFAAGVTPTQCFEMLALIRQKHPTIPIGLLMYANLVFSKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRYNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLVEKLQEYNAAPPLQGFGISSPEQVTGAIEAGAAGAISGSAIVKL
IEKNVANPGQMLTELKAFVTAMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgaaaacctgtttgcacagctgaaggatcgcaaggaaggcgcatttgtc
cccttcgtgaccctgggcgatccttccgttgaacagtcactgaacattattgatacgctg
attgaagccggcgccgacgcccttgaactcggcattccgttctccgatccgctggcagac
gggccgaccatccaggaagccacgctgcgcgcgtttgccgcaggcgtaacgcctacgcaa
tgctttgagatgctggcgctgattcgtcagaaacacccgacgattccgattggtctgctg
atgtacgccaacctggtattcagcaaagggatcgacgaattctacgcgcagtgcgagaaa
gtcggcgtggattccgtactggtggcggatgtgcctgttgaggagtctgcgcccttccgt
caggcggcattacgctacaacgtggcgccgattttcatctgcccgcccaatgccgatgac
gatctgttgcgccagatagcctcttatggccgcggctatacctatctgctttcgcgggca
ggcgtgacgggcgcagaaaaccgcgccgcattaccgctgcatcatctggtagaaaaactg
caagagtataacgccgcgcccccgttgcagggctttggcatctcttccccggaacaggtt
acaggtgccattgaagccggcgccgccggggcgatttccgggtcagcaatcgttaagctc
attgagaaaaacgtcgcaaaccccggccagatgctgaccgagctgaaagcgtttgtcacg
gcaatgaaagccgcgacccgcgcataa

DBGET integrated database retrieval system