KEGG   Citrobacter koseri: CKO_01337Help
Entry
CKO_01337         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cko  Citrobacter koseri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKO_01337
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKO_01337
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKO_01337
Enzymes [BR:cko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKO_01337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1304216..1305409)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPQFQAQFADLLKNYAGRPTALT
KCQNITAGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YESAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFINETSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEEGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattactcaatccctactttggtgaatttggcggcatgtatgtcccgcagatt
ctgatgcctgccctgcgccagctggaagaagcgttcgtcagtgcgcagaaagatccgcag
tttcaggcccagtttgccgatctgctgaagaactatgcaggccgtccaaccgcgctgacc
aaatgccagaatatcaccgccggcaccaaaaccacgctgtatctgaagcgtgaagattta
ctgcacggcggcgcgcacaaaacaaaccaggtactggggcaggcgctgctggcgaaacgc
atgggtaaaacagagattatcgccgaaacgggcgcaggtcagcatggcgtggcttccgcg
ctcgccagcgccctgctcggtctgaaatgccgtatctatatgggtgcaaaagacgtcgag
cgtcagtcgccaaacgtctttcgtatgcgactgatgggcgcggaagtgatccctgtacac
agcggctccgccaccctgaaagacgcctgcaacgaagcgcttcgcgactggtccggcagc
tatgaatccgcgcactatatgctcggtactgcggcaggcccgcacccgttcccgaccatc
gtccgtgaatttcagcgcatgatcggggaagagacgaaagcgcaaatcctcgaaaaagaa
ggtcgtctgccggatgccgtgattgcctgcgtgggcggcggctccaacgcaatcggcatg
tttgcggacttcatcaacgaaaccagcgtgggtttgattggcgtcgaacctggcggccac
gggattgaaacaggcgagcacggcgcaccgctgaagcatggccgcgtaggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagaagggcaaattgaagagtcctactccatt
tccgccgggctggatttcccgtccgttgggccgcagcatgcgtatctgaacagcattggt
cgcgccgattacgtgtcgatcaccgatgacgaagcgctggaagcctttaaaacgctctgt
ctgcatgaagggattattccggcgctggagtcgtcccatgccctggctcacgccctgaaa
atgatgcgtgaaaatccagaaaaagaacaattgctggtcgttaacctttccggtcgcggc
gacaaagacattttcaccgtacacgatattctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system