KEGG   Citrobacter koseri ATCC BAA-895: CKO_01543Help
Entry
CKO_01543         CDS       T00592                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cko00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cko00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cko00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1495726..1496640)
Genome map
AA seq 304 aa AA seqDB search
MDNSILETILQQVRPLIGQGKVADYIPALASVDGSKLGIAICTVDGQYYQAGDAQERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLELEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALSGVSDIAYDVTVARSEFEHSARNAAIAWLMKSFGNFQHD
VTTVLQNYFHYCALKMSCAELARTFVFLARQGQAFHLDEPVVTSMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAVLEQLTQQLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacaattcaattttagagaccatccttcagcaggtgcgcccgttgattggacagggg
aaagtggctgattacatccctgcgctggcttctgtcgatgggtcaaaactggggatcgcc
atttgcaccgttgacgggcaatactatcaggctggcgatgcgcaggaacgcttctcaata
caatccatatcaaaggtgctgagtctggtggtggcgatgcgtcactacccggaagaggaa
atctggcaacgtgtcggaaaagatccctccgggtcgccattcaattccttggtgcagctg
gaactggagcaagggataccgcgtaaccccttcattaatgccggcgcgctggtggtttgc
gatatgctgcaagggcgactgagcgcgccgcgccagcgtatgctggaagtggttcgggcg
cttagcggcgtgtcggatattgcgtatgacgtcacggttgcccgttctgaatttgagcac
tccgcacgcaatgccgctattgcctggctgatgaagtcatttggtaatttccagcatgat
gtcactaccgttttgcaaaattactttcactactgcgcgttgaaaatgagctgtgcggaa
ctggcgcgtacatttgtttttctggccagacaggggcaggcgtttcaccttgatgaaccg
gttgtcacgtcgatgcaggcccgacaaatcaacgcgctgatggcgaccagtggaatgtac
caaaacgcaggcgaatttgcctggcgagtaggattacctgccaagtcaggcgttggcggc
gggattgtggcgattgtcccgcatgaaatggcgattgcggtatggagccctgaactggac
ccggcgggcaactccctggcgggtattgcggtactcgaacaactcacccaacaattaggt
cgttcggtttactga

DBGET integrated database retrieval system