KEGG   Citrobacter koseri: CKO_01615Help
Entry
CKO_01615         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
cko  Citrobacter koseri
Pathway
cko00670  One carbon pool by folate
cko00790  Folate biosynthesis
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKO_01615
   00670 One carbon pool by folate
    CKO_01615
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CKO_01615
    1.5.1.50  dihydromonapterin reductase
     CKO_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABV12747
UniProt: A8AGY5
Position
1559420..1560160
Genome map
AA seq 246 aa AA seqDB search
MPKETTMGKNQPLPILITGGGRRIGLAIAWHFLNQKQPVIVSYRTHYPAIDGLTQAGALC
IQADFSTDDGVLAFAEKIKTHTPGLRAILHNASAWMAEAPGTPLSDVLACMMQIHVNTPY
LLNHALERLLRGHGHAATDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEV
KVNAIAPSLILFNENDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFAVD
GGRHLR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggagactacaatgggtaaaaaccagcccttgcccatccttatcacgggagga
ggccgccgcatcggcctcgcgatcgcgtggcactttctcaatcaaaaacagccggtgatt
gtcagctaccggacgcactatccagccatcgacggcctgacgcaagcgggcgcgctgtgc
attcaggccgatttttccaccgatgacggcgtcctggcatttgctgagaagataaagacc
catacgccaggcctgcgggctattttgcataacgccagcgcctggatggccgaggcgcct
ggcaccccgctctctgacgtgctggcatgcatgatgcagattcacgtcaatacgccctat
ctgttaaaccatgcgctggaaagactgttgcgcggccacggacatgcggccaccgatatc
atccattttacggactatgttgtggaacgcggcagcgacaaacacatcgcctatgccgcc
agtaaagcagcgctggataatatgacccgctcctttgcccgcaaactggccccggaagtg
aaagtcaacgccatcgccccgtcgctgatcctgtttaacgaaaacgacgacgccgagtac
cgtcagcaggcgctcaataaatccctgatgaagacagcgcccggcgagaaagaggtaatc
gacctggtggattaccttctcaccagctgcttcgttaccggccgcagtttcgccgtggat
ggcggccggcacctgcgttaa

DBGET integrated database retrieval system