KEGG   Citrobacter koseri: CKO_01615Help
Entry
CKO_01615         CDS       T00592                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
cko  Citrobacter koseri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKO_01615
   00670 One carbon pool by folate
    CKO_01615
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CKO_01615
    1.5.1.-  
     CKO_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559420..1560160
Genome map
AA seq 246 aa AA seqDB search
MPKETTMGKNQPLPILITGGGRRIGLAIAWHFLNQKQPVIVSYRTHYPAIDGLTQAGALC
IQADFSTDDGVLAFAEKIKTHTPGLRAILHNASAWMAEAPGTPLSDVLACMMQIHVNTPY
LLNHALERLLRGHGHAATDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEV
KVNAIAPSLILFNENDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFAVD
GGRHLR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggagactacaatgggtaaaaaccagcccttgcccatccttatcacgggagga
ggccgccgcatcggcctcgcgatcgcgtggcactttctcaatcaaaaacagccggtgatt
gtcagctaccggacgcactatccagccatcgacggcctgacgcaagcgggcgcgctgtgc
attcaggccgatttttccaccgatgacggcgtcctggcatttgctgagaagataaagacc
catacgccaggcctgcgggctattttgcataacgccagcgcctggatggccgaggcgcct
ggcaccccgctctctgacgtgctggcatgcatgatgcagattcacgtcaatacgccctat
ctgttaaaccatgcgctggaaagactgttgcgcggccacggacatgcggccaccgatatc
atccattttacggactatgttgtggaacgcggcagcgacaaacacatcgcctatgccgcc
agtaaagcagcgctggataatatgacccgctcctttgcccgcaaactggccccggaagtg
aaagtcaacgccatcgccccgtcgctgatcctgtttaacgaaaacgacgacgccgagtac
cgtcagcaggcgctcaataaatccctgatgaagacagcgcccggcgagaaagaggtaatc
gacctggtggattaccttctcaccagctgcttcgttaccggccgcagtttcgccgtggat
ggcggccggcacctgcgttaa

DBGET integrated database retrieval system