KEGG   Citrobacter koseri: CKO_01736Help
Entry
CKO_01736         CDS       T00592                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cko  Citrobacter koseri
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CKO_01736 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CKO_01736 (btuE)
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CKO_01736 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1659374..1659937)
Genome map
AA seq 187 aa AA seqDB search
MGDAMQDTILNTEVTTIDGDVTTLEKYAGNVLLVVNVASKCGLTPQYEQLENIQKAWADQ
GFTVLGFPCNQFLGQEPGTEEEIKTYCSTTWGVTFPMFSKVDVNGENRHPLYQKLIAAAP
AAVAPEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPGMVES
IKIALAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgctatgcaagataccattctcaacactgaagtgacgacgatcgacggggat
gtcaccacgcttgagaagtacgccggaaacgtactgctggtggttaatgtggcctcgaaa
tgtggcttaacgccacaatacgaacagctggagaatattcagaaagcctgggccgatcag
ggctttacggtgttaggttttccctgcaaccagtttcttggtcaggaacctggcactgaa
gaggagattaaaacctattgcagcaccacctggggcgtcacattcccgatgttcagcaag
gttgacgtcaatggtgagaaccgccatccactgtatcagaagttgattgccgcagcgcct
gccgccgttgcgccggaaggtagcggtttctatgagcgcatggcgagtaaaggccgcgcg
ccgctttacccggacgatattttgtggaactttgagaagtttttaatcggcagggatgga
caggtcgtacagcgtttctcaccggacatgacgcctgaagatccggggatggtggaaagt
atcaaaatcgcgttggcaaaataa

DBGET integrated database retrieval system