KEGG   Citrobacter koseri: CKO_01748Help
Entry
CKO_01748         CDS       T00592                                 

Definition
6-phosphofructokinase 2
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_01748
   01230 Biosynthesis of amino acids
    CKO_01748
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_01748
   00030 Pentose phosphate pathway
    CKO_01748
   00051 Fructose and mannose metabolism
    CKO_01748
   00052 Galactose metabolism
    CKO_01748
  Energy metabolism
   00680 Methane metabolism
    CKO_01748
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CKO_01748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670849..1671778
Genome map
AA seq 309 aa AA seqDB search
MIRIYTLTLAPSLDSATITPQLYPEGKLRCSSPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVVTIDAKDWTRQNLHVHVESSGEQYRFVMPGAALDDDEFRQ
IEEQVLEIESGAILVISGSLPPGVKLEKLTQLIAAAQKQGIRCIIDSSGDALNAALSLGN
IELVKPNQKELSALVNRELTQPDDVRQAAQEIVKSGKARRVVVSLGPQGALAVDSESCVQ
VVPPPVRSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVSAGSAATLNQGTRLCSRDDT
QKIYAWLSQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtatctatacgttaacacttgcgccctctctcgatagcgcaacaatcacccca
caactctatcccgaagggaaacttcgctgttcatcacctgtttttgaacccggcggcggc
ggaatcaacgttgcccgcgcgattgcccatcttggcggaaccgcaaccgcgattttcccc
gctggcggcgcgaccggcgaacatctggtcgcacttctggccgatgaaaacgtccccgtc
gtcaccatcgatgccaaagactggacgcgacaaaacctgcatgttcatgtggagtccagc
ggggagcaatatcgctttgtcatgcccggcgccgcactcgacgatgacgaatttcgccag
attgaagaacaggttctggagatcgaatccggcgccattttggttatcagcgggagtctg
ccgcccggcgtcaagctggaaaaactgacgcagcttattgccgccgcgcagaaacagggc
atccgctgcattattgatagttcgggcgatgcgctcaacgcggcgttatctctcggcaat
attgaactggtcaaaccgaaccaaaaagagctgagcgcgctggttaatcgcgaactcacg
cagcctgacgatgtgcgccaagcggcgcaggaaatcgtgaagagcggcaaagcgcgccgc
gtcgttgtttctctggggccgcagggggcgctggcggtggatagcgaaagctgcgtccag
gttgttccccctcccgtcagaagtcaaagtaccgtcggcgcgggcgacagcatggttggc
gcaatgacgctaaaactggcggaaaacgcctcgctggaagagatggtgcgtttcggcgtc
tcggcaggcagcgcggcgacgttgaatcaaggaacacgtctgtgttcccgggacgatacg
cagaaaatctacgcctggctttctcagtga

DBGET integrated database retrieval system