KEGG   Citrobacter koseri: CKO_01797Help
Entry
CKO_01797         CDS       T00592                                 

Definition
(RefSeq) nicotinamidase/pyrazinamidase
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cko  Citrobacter koseri
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CKO_01797
Enzymes [BR:cko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CKO_01797
    3.5.1.-  
     CKO_01797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710231..1710872
Genome map
AA seq 213 aa AA seqDB search
MTTRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIAWCKARGDTVIASQDWHPAGHGS
FASQHQAQPYSQGQLDGLAQTFWPDHCVQNSDGAALHPLLRQNAIDAVFHKGENPQVDSY
SAFFDNGRRQKTALDAWLRENGVQTLIVMGLATDYCVKFTVLDALQLGYTVNVITDGCRG
VNIQPQDSTHAFMEMAAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgagccttactgctggttgatttgcagaatgatttttgcgccggcggcgca
ctggccgtccctgaaggcgacagcaccgtggacgtagcaaaccgtcttatcgcctggtgt
aaagcgcgcggcgacacagtgatcgccagccaggactggcatcctgccggacacggcagt
ttcgccagccagcatcaggcgcagccctacagccagggacaactggacggtttagcgcaa
accttctggcccgatcactgcgtacaaaatagcgacggcgcggccctgcatcccctgctc
aggcagaacgccatcgacgcggttttccataaaggcgagaatccgcaggtggacagctac
agcgccttttttgataacggacgccgccagaaaaccgccctggacgcctggcttcgtgag
aacggcgtacagacgctgatcgtgatggggctggcgaccgattactgcgtgaagtttacc
gtgctggatgcgctgcaactgggttatacggtgaatgtgattaccgacggctgccgtggt
gtgaatattcaaccgcaagacagcacgcacgcctttatggagatggcggccgctggcgcc
acgctgtatacgctggctgactgggaagaaacgcagggttag

DBGET integrated database retrieval system