KEGG   Citrobacter koseri: CKO_01801Help
Entry
CKO_01801         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_01801
Enzymes [BR:cko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CKO_01801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1713130..1714014
Genome map
AA seq 294 aa AA seqDB search
MINTIFALPVIKQITPVLSRRQLDELDVIVVDHPQVKASFALQGAHLLSWKPAGAEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPSAQQGLPSHGFARNLPWALKAHNEDDNGAVLTFE
LQSSEATRQYWPHDFTLLARFKVGKTCEIELEAHGEFETTSALHTYFNVGDISAVKVSGL
GDRFIDKVNDAKEDVLADGVQTFPDRTDRVYLNPEACSVIHDDALNRNIDVIHHHNINVV
GWNPGPALAASMGDMPDDGYKTFVCVETAYATAPQKASEEKPSRLVQTIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacaattttcgctctcccggtcatcaaacaaattacccctgtcctctcccgc
cgccagctcgacgagcttgacgtgatcgtcgtcgatcacccgcaagttaaggcgtctttt
gcactccagggcgcacatttgctctcctggaaaccagcaggcgccgaagaagtgctgtgg
ctgagcaacaacacaccgtttaaaacaggcgttgcgctgcgtggcggcgtaccgatctgc
tggccgtggtttggcccctctgcgcagcagggtctgccgtctcacggctttgcccgtaac
ctgccgtgggcgctgaaagcccacaacgaagacgacaacggcgcggtactgacatttgag
ctacagagcagtgaggcgactcgccagtactggccgcacgatttcaccctgcttgcgcgc
ttcaaagtgggtaaaacctgtgagatcgaactggaagcccacggcgaattcgaaaccacg
tctgccctgcacacctactttaacgtcggcgatatctccgcagttaaggtcagcggcctt
ggcgaccgtttcattgataaagtgaacgacgccaaagaagatgtgctggcagacggcgtc
cagacgttcccggatcgtactgaccgcgtttacctgaacccggaagcctgtagcgtcatc
catgatgatgcgctgaaccgcaacattgacgtcatccaccatcacaacattaacgttgtg
ggatggaaccctggcccggcactcgccgccagcatgggcgacatgccggatgatggctac
aaaacctttgtctgtgtggaaacggcttatgccaccgcgccgcaaaaagccagcgaagaa
aaaccgtctcgcctggtgcaaacaattcgcgtcgcaaaacgttaa

DBGET integrated database retrieval system