KEGG   Citrobacter koseri ATCC BAA-895: CKO_01876Help
Entry
CKO_01876         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cko  Citrobacter koseri ATCC BAA-895
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774257..1774787)
Genome map
AA seq 176 aa AA seqDB search
MMGWRAKLSAAVLALVLAGAPASVILDQFLNEKEGNSLTAYKDGGGIWTICRGATMVDGK
PVVQGMKLTQAKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGSGKCLPS
GFFRKLNAGDRKGACAEIRRWIFDGGKDCRIRSNNCFGQVSRRDQESALTCWGIDQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatggggtggagagcaaaacttagtgccgccgttctggcactggttctcgccggtgcg
ccagcgtcggttattctcgatcagttcctgaatgagaaagagggtaacagtctgacagcg
tacaaagatggtggcgggatctggacgatttgccgtggcgccacaatggttgatggtaaa
ccggtggtgcagggcatgaagctgacgcaggcgaaatgtgaccaggtaaacgccattgag
cgcgataaagcgctggcctgggtagagcgaaatatcaaagtaccactgacagaaccacag
aaagcggggatcgcgtcgttctgcccgtacaacatcggctctggtaaatgcctgccatct
ggattttttcgtaagctgaacgcaggagaccgcaaaggggcctgtgctgaaatcaggcgt
tggatattcgacggcggaaaagattgccgcattcgctccaataactgctttgggcaggtt
tcccgtcgcgaccaggaaagcgcgcttacgtgctgggggatagaccagtga

DBGET integrated database retrieval system