KEGG   Citrobacter koseri: CKO_02362Help
Entry
CKO_02362         CDS       T00592                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cko  Citrobacter koseri
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKO_02362
   00500 Starch and sucrose metabolism
    CKO_02362
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CKO_02362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2187136..2188419
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQIPSDQTAPGTSSRPILSANEAQNFVAAHYFS
SLTPNTAPWTPSAITLPAQPDFVVGPAGTPGVTHTTIQAAVDAAITQRSSKRLYIAIMPG
EYQGTVYIPAAPGSLTLYGTGENAIDVKIGQAIDGEMSTTDWRRSVNPGGKYMPGKPAWY
MFDNCQSKRGASIGVMCSAVVWSQNDGLQLQNLTIENNLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQNDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTDF
RVVNSRTQQEAYVFAPATLSNIYYGFLATNSRFTAAGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNMAKPWADAVISKRPFAGNTGAKDDKDEVQRNLNDTNFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcggtttcccgtctggcgctggcactggcttttggcgtgacgctgacc
gcctgtagctctacgccgcccgatcaaatcccatccgatcagaccgcgccaggcacctcc
tcgcgtccgatcctgtcggcgaacgaagcgcagaatttcgttgctgcacactatttctcg
tcactgacgccgaatacggcgccgtggacgccttccgccattacgctgcctgcgcaacct
gacttcgttgtcggcccggctggcacgccaggcgtgacgcacaccaccattcaggcggcg
gtagatgcagcaattacgcagcgcagcagcaagcgtctgtacatcgccattatgccgggc
gagtatcagggaaccgtgtatatcccggcggcgcctggcagcctgacgctgtacggcacg
ggcgagaacgcgattgatgtgaaaatcggccaggcgattgacggcgaaatgagcacgacc
gactggcgtcgttcagtgaacccgggcggtaaatacatgccgggcaaacctgcgtggtat
atgtttgataactgccagagcaaacgcggcgccagcattggcgtgatgtgttctgcggtg
gtctggtcacagaatgacggcttgcagttacaaaatctgaccatcgaaaacaatctcggt
gacagcgttgacgccggcaaccatccggcagtggccttacgcactgacggcgacaaagtg
cagattaataaagtgaacattctgggtcgccagaataccttcttcgtgaccaacagcggc
gtgcagaaccgtctgcaaaacgatcgccaaccacgcacgctggtgacgaacagttacatt
gaaggggatgtggatatggtttccggtcgcggcgcagtggtgttcgataacaccgatttc
cgcgtggtgaactcccgtacccagcaggaagcgtatgttttcgctccggcaacgctgtcg
aatatttattacggtttcctcgccaccaacagccgctttaccgccgcaggtgatggcgtc
gcgcaactgggtcgttcgctggatgtggatgccaacaccaacggtcaggtcgttatccgc
gatagcgtgattaacgaagggttcaatatggcgaaaccgtgggctgacgccgttatctcc
aaacgtccttttgccgggaatactggcgcgaaggatgataaagacgaggtacagcgtaac
ctgaacgacacgaactttaaccggatgtgggaatacaacaaccggggtttaggcagtaaa
gtggttgccgaaccgaagcaataa

DBGET integrated database retrieval system