KEGG   Citrobacter koseri: CKO_02437Help
Entry
CKO_02437         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cko  Citrobacter koseri
Pathway
cko00020  Citrate cycle (TCA cycle)
cko00190  Oxidative phosphorylation
cko00650  Butanoate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
Module
cko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cko_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKO_02437
   00650 Butanoate metabolism
    CKO_02437
  Energy metabolism
   00190 Oxidative phosphorylation
    CKO_02437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS CbtB
Motif
Other DBs
NCBI-ProteinID: ABV13554
UniProt: A8AJ91
Position
complement(2254921..2255268)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIVYMVGFFAISGELTFDVWSGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgaccctctacatcgtttatatggtgggctttttcgcaataagc
ggcgagctgacctttgatgtctggagcggtttcttctcatcggcattcaccaaagtcttc
accctgctggcacttttctccatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaacctctggccctgcgccttgtgctacagctggcaatcgttgttgcg
ctggtggtttacgtcatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system