KEGG   Citrobacter koseri: CKO_02646Help
Entry
CKO_02646         CDS       T00592                                 

Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cko  Citrobacter koseri
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CKO_02646
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CKO_02646
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CKO_02646
Lipid biosynthesis proteins [BR:cko01004]
 Fatty acid synthase
  Component type
   CKO_02646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2448749..2449342
Genome map
AA seq 197 aa AA seqDB search
MPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQDKTPVINASISGD
TSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRKILLDVKAANAEPLLM
QIRLPANYGRRYNETFSAIYPRLAKEFDIPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMAQQLTPLVNHDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcctgtttctggtcctgttaacgttccgcgccgccgcagcggacacgttatta
attctgggtgacagcctgagcgccggataccgcatgtccgccagcgcggcctggcctgcg
ctgcttaacgacaaatggcaggacaaaacgccggtcatcaatgccagcattagcggcgac
acctcgcagcaaggcctggcgcgtctgcctgcgctgctgaagcagcatcagccccgctgg
gttctggtcgagcttggcggcaatgacggcctgcgcggttttcaacctcagcaaaccgag
caaaccctgcgtaaaatcctgctggatgtgaaggccgcaaacgccgagccgttgctcatg
caaattcgtctgcccgcaaactatggtcgccgttataatgaaacctttagcgccatctac
ccacggcttgccaaagagtttgatattccgcttctgcccttttttatggaagaggtttat
ctgaaaccacaatggatgcaggacgacggtattcatcctaatcgcgacgcccagccgttt
attgccgactggatggcgcaacaactaaccccattagttaaccacgactcgtaa

DBGET integrated database retrieval system