KEGG   Citrobacter koseri: CKO_02807Help
Entry
CKO_02807         CDS       T00592                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cko  Citrobacter koseri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKO_02807
Enzymes [BR:cko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CKO_02807
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_02807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2601406..2602380
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDDTGSDAWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRDRTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctaatccaacgcccccgtcgcctgcgcaaatccgctgcgctgcgcgccatg
tttgaagagacaacactcagtttaaacgacctggtgttgccgatttttgttgaagaagaa
ctcgacgactacaaagcgatcgacgccatgcctggcgtcatgcgcattcctgaaaaacac
ctggcgcgcgagattgaacgcatcgccaacgccggcattcggtcagtgatgaccttcggc
atttcccaccataccgacgacaccggcagcgatgcctggaaagaagacggcctggtggcg
cgcatgtcacgcatctgcaagcaaaccgtgccagaaatgatcgtgatgtctgacacctgt
ttctgtgagtacacctcccacggtcactgcggcgtgctgtgcgaacacggcgtcgacaac
gatgcaaccctggcgaacctcggtaaacaagcggtggtcgccgccgctgcgggcgctgat
tttattgccccttccgccgcgatggacggtcaggtgcaggcgattcgccaggcgctggat
gccgccggttttacggatacggccatcatgtcctactccaccaagttcgcctcctctttc
tacggcccgttccgtgaagcggccggtacggcactgaaaggcgatcgtaagacctatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgagtcgttgctcgacgaagcgcagggc
gcggactgcctgatggtgaaacccgctggcgcttatctggatattctgcgtgatatccgc
gatcgtaccgaattaccgctcggcgcgtatcaggtcagcggcgaatacgccatgatcaaa
ttcgccgcgatggcgggcgcgatcgacgaagagaaagtggtgctggaaagcttaggctcg
atcaaacgcgcgggcgcggatctgatcttcagctacttcgcgctggatctggcggagaaa
aaaatcctgcgttaa

DBGET integrated database retrieval system