KEGG   Citrobacter koseri: CKO_02825Help
Entry
CKO_02825         CDS       T00592                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cko  Citrobacter koseri
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CKO_02825 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    CKO_02825 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CKO_02825 (lacZ)
Enzymes [BR:cko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CKO_02825 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618568..2621645
Genome map
AA seq 1025 aa AA seqDB search
MPQNADSLAVVLKCRDWENPGVTQLNRLEAHPPFCSWRNADDARVNRDSAQKRSLNGEWT
FAWFSAPEAVPESWRTSDLQQADSVRVPSNWQMDGYDAPIYTNVTYPIPVNPPFVPADNP
TGCYSLTFSIDADWLQAGQTRIIFDGVNSAFHLWCNSRWVGYGQDSRLPSEFDLTHFLLK
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPATQIRDLRINTRFNDDFSRAV
LEAEVRTTGERRDDLRVTVQLWDSETFVGEKTAPLGSEIIDERGAYPDRTTLRLNVEHPA
LWSAETPHLYRAVVQLHAADGTLIEAEACDVGFRQVSIENGLLLLNGKPLLIRGANRHEH
HPENGQVMDKETMIKDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLSDDPVWLPAMSQRVTRMVQRDRNHPSIIIWSLGNESGHGANHDALYRWIKSED
PSRPVQYEGGGANTAATDIICPMYARVDQDQPFPAVPKWSIKKWLSMPGEQRPLILCEYA
HAMGNSLGGYAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDDDGRPWSAYGGDFGDAPNDR
QFCMNGLVFADRTPHPSLYEAKHAQQFFQFALLPGAECQIEVTSEYLFRHSDNEVLHWSL
ALDGNPLTAGVVTLDIPPQGRQIIALPALPEAETAGQLWLTVRVEQPQATAWSQAGHISA
WQQWKLGEKLATQWPQHAGNAPQLTSSGTAFRIVAGEKRWEFSRQQGVLTQFWIGEEAQL
LTPLVDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAKAVLLQCDADTLASAVLI
TTAHAWQYQGETLFISRKTYRIDGNGEMQITVDVDVASGTPHPARIGLSCQLAQVAERVN
WLGLGPHENYPDRLSAACFERWDLPLEEMYTPYVFPSENGLRCGTRELLYGAHQWRGDFQ
FNISRYGQKQLMETSHRHLLQPEAGTWLNIDGFHMGVGGDDSWSPSVSAEYQLSAGRYHY
QISWR
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgccccagaatgcagattcactcgccgtcgttctgaaatgtcgcgactgggaaaaccct
ggcgtaacgcaacttaatcgcctggaggcgcaccctcctttttgtagctggcgtaatgcc
gatgacgcccgcgtgaaccgtgactccgcacaaaagcgcagcctgaacggtgaatggacg
tttgcctggttttcagcgcctgaagcagtaccagagagctggcggacaagcgatctgcaa
caggcggatagcgtgcgcgtgccgtctaactggcaaatggacggttacgacgcccccatt
tataccaacgtcacctatcccattccggttaacccgccgttcgttccggcagataaccca
accggatgttactcgctcacattcagtattgacgcagactggctacaggcaggccagacg
cggatcatttttgatggcgtgaactccgccttccatttgtggtgcaacagtcgctgggtc
ggatacggtcaggacagccgtctgccgtctgaattcgatctcacgcattttttgcttaag
ggtgaaaaccgcctcgcggtaatggtgctgcgctggagtgacggcagctatctggaagat
caggatatgtggcggatgagcggcatctttcgcgacgtctcgctgctgcataaaccggca
acgcaaatccgtgacctgcgcatcaacacccgcttcaacgatgatttcagccgcgcagtg
ctggaagcggaggtcagaacaacgggggaacgacgcgatgatttacgcgtgacggtacag
ctgtgggatagcgaaacattcgtcggagaaaaaaccgctccgctcggcagcgagatcatt
gatgagcgcggcgcttaccctgatcgcacaacccttcgtctgaatgtcgaacacccggcg
ctgtggagcgcggagaccccgcatctgtatcgtgccgttgtacagctacacgccgccgat
ggcacgctgattgaagccgaagcctgcgacgtcggtttccgtcaggtcagcattgaaaac
ggtctgctgctgttaaacggtaagccgctgctgatccgcggcgccaaccgccatgaacat
cacccggaaaacggccaggtgatggacaaagagaccatgattaaagacattctgctgatg
aagcagaacaattttaacgccgtgcgctgctcccattatccgaatcacccgctgtggtac
accctgtgcgatcgctacggcctgtacgtggtggatgaggccaatatcgaaacccacggc
atggtgccgatgaatcgcctgagcgacgatccggtctggctgcccgccatgagccagcgc
gtgacgcggatggtacagcgcgaccgcaaccatccgagcattattatctggtcactgggc
aacgagtccgggcacggcgccaaccacgacgcgctgtaccgctggattaagtcggaagat
ccctcccgccccgtgcagtatgaaggcggcggcgcgaatacggcggcaaccgacatcatt
tgcccgatgtacgcccgcgtcgatcaggatcagcccttccccgccgtaccgaaatggtcg
atcaaaaaatggctgtcgatgccgggcgagcagcgcccgctgatcctgtgtgaatacgcc
cacgcgatgggcaacagcctcggcggttacgcgaaatactggcaggcgtttcgccagtat
ccgcgcctgcaaggcggttttgtctgggactgggtggatcagtcgcttatcaaatatgac
gacgacggtcggccgtggtcagcctacggcggcgactttggcgacgcgcctaacgaccgt
cagttctgtatgaacggcctggtgttcgccgaccgaacaccgcatccgtcactgtatgaa
gccaaacacgcgcagcagtttttccagtttgcgctgctgccgggagccgaatgccagatt
gaagtgaccagcgaatacctgttccgccatagcgataacgaagtgctccactggtcactg
gcgctggatggcaacccgctgaccgcaggcgttgtgacgctggatatcccgccgcaggga
cgccagatcatcgcgctgccagcgctcccggaagcggaaaccgcaggccagctgtggctg
acggtacgcgttgaacaaccgcaggcaaccgcgtggtcgcaagccggacatatcagcgcc
tggcaacagtggaaactcggcgaaaaactcgctacacagtggccgcagcacgctggcaac
gcgccacagctcaccagcagcgggacggcattccgtattgtcgcaggcgagaaacgctgg
gagttcagccgccagcagggcgtattaacgcagttctggattggcgaagaggcacagttg
ctgactccgcttgtcgatcagttcacccgcgcgccgctggacaacgacatcggcgtgagc
gaggcaacccgtatcgaccctaacgcctgggttgaacgctggaaggccgccggccattac
caggctaaagcggtattactgcaatgcgatgccgacacgcttgccagcgcggtactgatt
accaccgcccacgcctggcagtatcagggcgagacgctgttcatcagccggaaaacctac
cgtatcgacggcaacggtgaaatgcagataacggtagatgttgatgtcgccagcgggaca
ccgcatccggcgcgcatcggactgagctgccagcttgcgcaggtggcggagcgggtcaac
tggctggggttaggcccgcacgagaactacccggatcgtctctctgccgcctgttttgag
cgctgggatctgccgctggaagagatgtacaccccgtatgttttcccgagcgaaaacggc
ctgcgctgcggaacgcgtgaattgctctatggtgcgcatcagtggcgcggcgattttcag
ttcaacatcagccgctacggccagaaacagctgatggaaaccagccaccgccatctgctc
cagccggaagcgggcacctggctcaatattgacggtttccatatgggcgtaggcggcgat
gactcctggagcccctccgtttcagcggaatatcagctcagcgccgggcgctaccactac
cagataagctggcggtaa

DBGET integrated database retrieval system