KEGG   Citrobacter koseri ATCC BAA-895: CKO_02825Help
Entry
CKO_02825         CDS       T00592                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cko00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cko00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618568..2621645
Genome map
AA seq 1025 aa AA seqDB search
MPQNADSLAVVLKCRDWENPGVTQLNRLEAHPPFCSWRNADDARVNRDSAQKRSLNGEWT
FAWFSAPEAVPESWRTSDLQQADSVRVPSNWQMDGYDAPIYTNVTYPIPVNPPFVPADNP
TGCYSLTFSIDADWLQAGQTRIIFDGVNSAFHLWCNSRWVGYGQDSRLPSEFDLTHFLLK
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPATQIRDLRINTRFNDDFSRAV
LEAEVRTTGERRDDLRVTVQLWDSETFVGEKTAPLGSEIIDERGAYPDRTTLRLNVEHPA
LWSAETPHLYRAVVQLHAADGTLIEAEACDVGFRQVSIENGLLLLNGKPLLIRGANRHEH
HPENGQVMDKETMIKDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLSDDPVWLPAMSQRVTRMVQRDRNHPSIIIWSLGNESGHGANHDALYRWIKSED
PSRPVQYEGGGANTAATDIICPMYARVDQDQPFPAVPKWSIKKWLSMPGEQRPLILCEYA
HAMGNSLGGYAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDDDGRPWSAYGGDFGDAPNDR
QFCMNGLVFADRTPHPSLYEAKHAQQFFQFALLPGAECQIEVTSEYLFRHSDNEVLHWSL
ALDGNPLTAGVVTLDIPPQGRQIIALPALPEAETAGQLWLTVRVEQPQATAWSQAGHISA
WQQWKLGEKLATQWPQHAGNAPQLTSSGTAFRIVAGEKRWEFSRQQGVLTQFWIGEEAQL
LTPLVDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAKAVLLQCDADTLASAVLI
TTAHAWQYQGETLFISRKTYRIDGNGEMQITVDVDVASGTPHPARIGLSCQLAQVAERVN
WLGLGPHENYPDRLSAACFERWDLPLEEMYTPYVFPSENGLRCGTRELLYGAHQWRGDFQ
FNISRYGQKQLMETSHRHLLQPEAGTWLNIDGFHMGVGGDDSWSPSVSAEYQLSAGRYHY
QISWR
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgccccagaatgcagattcactcgccgtcgttctgaaatgtcgcgactgggaaaaccct
ggcgtaacgcaacttaatcgcctggaggcgcaccctcctttttgtagctggcgtaatgcc
gatgacgcccgcgtgaaccgtgactccgcacaaaagcgcagcctgaacggtgaatggacg
tttgcctggttttcagcgcctgaagcagtaccagagagctggcggacaagcgatctgcaa
caggcggatagcgtgcgcgtgccgtctaactggcaaatggacggttacgacgcccccatt
tataccaacgtcacctatcccattccggttaacccgccgttcgttccggcagataaccca
accggatgttactcgctcacattcagtattgacgcagactggctacaggcaggccagacg
cggatcatttttgatggcgtgaactccgccttccatttgtggtgcaacagtcgctgggtc
ggatacggtcaggacagccgtctgccgtctgaattcgatctcacgcattttttgcttaag
ggtgaaaaccgcctcgcggtaatggtgctgcgctggagtgacggcagctatctggaagat
caggatatgtggcggatgagcggcatctttcgcgacgtctcgctgctgcataaaccggca
acgcaaatccgtgacctgcgcatcaacacccgcttcaacgatgatttcagccgcgcagtg
ctggaagcggaggtcagaacaacgggggaacgacgcgatgatttacgcgtgacggtacag
ctgtgggatagcgaaacattcgtcggagaaaaaaccgctccgctcggcagcgagatcatt
gatgagcgcggcgcttaccctgatcgcacaacccttcgtctgaatgtcgaacacccggcg
ctgtggagcgcggagaccccgcatctgtatcgtgccgttgtacagctacacgccgccgat
ggcacgctgattgaagccgaagcctgcgacgtcggtttccgtcaggtcagcattgaaaac
ggtctgctgctgttaaacggtaagccgctgctgatccgcggcgccaaccgccatgaacat
cacccggaaaacggccaggtgatggacaaagagaccatgattaaagacattctgctgatg
aagcagaacaattttaacgccgtgcgctgctcccattatccgaatcacccgctgtggtac
accctgtgcgatcgctacggcctgtacgtggtggatgaggccaatatcgaaacccacggc
atggtgccgatgaatcgcctgagcgacgatccggtctggctgcccgccatgagccagcgc
gtgacgcggatggtacagcgcgaccgcaaccatccgagcattattatctggtcactgggc
aacgagtccgggcacggcgccaaccacgacgcgctgtaccgctggattaagtcggaagat
ccctcccgccccgtgcagtatgaaggcggcggcgcgaatacggcggcaaccgacatcatt
tgcccgatgtacgcccgcgtcgatcaggatcagcccttccccgccgtaccgaaatggtcg
atcaaaaaatggctgtcgatgccgggcgagcagcgcccgctgatcctgtgtgaatacgcc
cacgcgatgggcaacagcctcggcggttacgcgaaatactggcaggcgtttcgccagtat
ccgcgcctgcaaggcggttttgtctgggactgggtggatcagtcgcttatcaaatatgac
gacgacggtcggccgtggtcagcctacggcggcgactttggcgacgcgcctaacgaccgt
cagttctgtatgaacggcctggtgttcgccgaccgaacaccgcatccgtcactgtatgaa
gccaaacacgcgcagcagtttttccagtttgcgctgctgccgggagccgaatgccagatt
gaagtgaccagcgaatacctgttccgccatagcgataacgaagtgctccactggtcactg
gcgctggatggcaacccgctgaccgcaggcgttgtgacgctggatatcccgccgcaggga
cgccagatcatcgcgctgccagcgctcccggaagcggaaaccgcaggccagctgtggctg
acggtacgcgttgaacaaccgcaggcaaccgcgtggtcgcaagccggacatatcagcgcc
tggcaacagtggaaactcggcgaaaaactcgctacacagtggccgcagcacgctggcaac
gcgccacagctcaccagcagcgggacggcattccgtattgtcgcaggcgagaaacgctgg
gagttcagccgccagcagggcgtattaacgcagttctggattggcgaagaggcacagttg
ctgactccgcttgtcgatcagttcacccgcgcgccgctggacaacgacatcggcgtgagc
gaggcaacccgtatcgaccctaacgcctgggttgaacgctggaaggccgccggccattac
caggctaaagcggtattactgcaatgcgatgccgacacgcttgccagcgcggtactgatt
accaccgcccacgcctggcagtatcagggcgagacgctgttcatcagccggaaaacctac
cgtatcgacggcaacggtgaaatgcagataacggtagatgttgatgtcgccagcgggaca
ccgcatccggcgcgcatcggactgagctgccagcttgcgcaggtggcggagcgggtcaac
tggctggggttaggcccgcacgagaactacccggatcgtctctctgccgcctgttttgag
cgctgggatctgccgctggaagagatgtacaccccgtatgttttcccgagcgaaaacggc
ctgcgctgcggaacgcgtgaattgctctatggtgcgcatcagtggcgcggcgattttcag
ttcaacatcagccgctacggccagaaacagctgatggaaaccagccaccgccatctgctc
cagccggaagcgggcacctggctcaatattgacggtttccatatgggcgtaggcggcgat
gactcctggagcccctccgtttcagcggaatatcagctcagcgccgggcgctaccactac
cagataagctggcggtaa

DBGET integrated database retrieval system