KEGG   Citrobacter koseri: CKO_03072Help
Entry
CKO_03072         CDS       T00592                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cko  Citrobacter koseri
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CKO_03072 (glpK)
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CKO_03072 (glpK)
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_03072 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2848987..2850495
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKAGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTAEICERLKRDG
MEDYIRNNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLDALDIPRAMLPEVRRSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NFRYSGWKKAVKRALAWEDHEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgccgtc
gtgatggatcacgatgcgaatatcgttagcgtgtcgcaacgtgaatttgagcaaatctac
ccgaaagcaggctgggtagaacacgacccaatggaaatctgggccacccaaagctcaacg
ctggttgaagtgctggcgaaagcagacatcagttccgatcagatcgcagcaatcggtatt
actaaccagcgtgaaaccaccatcgtctgggaacgtgaaaccggcaaaccgatttataac
gcaattgtctggcagtgccgccgtaccgccgaaatctgcgaacgcctgaagcgtgacggc
atggaagattacatccgcaacaacaccggtctggtgattgacccgtacttctccggcacc
aaagtgaagtggattctcgatcacgtagaaggctcccgtgagcgcgcacgtcgcggtgaa
ctgctgttcggtacggtggatacctggcttatctggaaaatgacgcagggacgcgtacac
gtcacggattacaccaacgcttcacgtaccatgctgttcaacatccataccctggactgg
gatgacaaaatgctggatgcgctggatatcccgcgcgctatgctgccggaagtgcgtcgt
tcttcagaagtgtacggccagacgaacatcgggggtaaaggcggcacgcgtattccaatc
gccgggatcgccggtgaccagcaggcggcgctgttcggccagctgtgcgtcaaagagggg
atggcgaaaaacacttacggcaccggctgctttatgctgatgaacaccggcgagaaagcg
gttaagtccgaaaacggacttttgaccaccatcgcctgtggcccgaccggcgaagtgaac
tatgcgctggaaggggcggtgtttatggctggcgcatccattcagtggctgcgtgatgag
atgaaactcatcagcgacgcattcgactctgaatatttcgccaccaaagtgaaagacacc
aacggcgtatacgttgtaccggcctttaccggtctgggcgcgccgtactgggacccgtat
gcgcgcggcgccatcttcggtctgacccgtggcgtaaactccaaccacatcatccgtgca
acgctggaatcgatcgcttaccagacgcgcgacgtgctggaagcgatgcaggcggactcc
ggtattcgcctgcacgccctgcgcgttgacggcggcgcggttgccaacaacttcctgatg
cagttccagtcagacattcttggtacgcgcgttgagcgcccggaagtgcgcgaagtgacg
gcgctgggtgcggcgtatctggcaggtctggcggtgggttactggcagaacctggatgag
ttgcaggaaaaagcggtcatcgagcgtgaattccgtccaggcatcgaaaccaccgagcgt
aacttccgttacagcggctggaaaaaagcggtcaaacgcgccctggcgtgggaagaccac
gaagagtaa

DBGET integrated database retrieval system