KEGG   Citrobacter koseri: CKO_03079Help
Entry
CKO_03079         CDS       T00592                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_03079 (tpiA)
   01230 Biosynthesis of amino acids
    CKO_03079 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_03079 (tpiA)
   00051 Fructose and mannose metabolism
    CKO_03079 (tpiA)
   00562 Inositol phosphate metabolism
    CKO_03079 (tpiA)
Enzymes [BR:cko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CKO_03079 (tpiA)
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CKO_03079 (tpiA)
  Exosomal proteins of bladder cancer cells
   CKO_03079 (tpiA)
  Exosomal proteins of melanoma cells
   CKO_03079 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2854685..2855434
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELAGVAGCAVAIAPPEMYIDMAKHAAAGSHIILGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNAANAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgagctggtggctaacctg
cgtaaagaactggctggcgttgctggctgtgcagttgcgattgcaccgccggaaatgtat
atcgacatggcgaaacacgccgctgccggtagccacatcattctgggcgcgcagaacgtt
gacctgaacctgtctggcgcattcaccggtgaaacttctgctgaaatgctgaaggatatc
ggcgcgcagtacatcatcatcggccactctgagcgtcgtacttaccacaaagagtctgac
gagctgatcgcgaagaaattcgccgtgctgaaagagcagggtctgactccggttctgtgc
atcggtgaaaccgaagcagaaaacgaagctggcaaaaccgaagaagtctgtgctcgtcag
atcgacgcggtactgaaaactcagggcgctgcggcgtttgaaggcgtggttatcgcttac
gaacctgtatgggcgatcggtactggcaaatccgccactccggcgcaggcgcaggctgtt
cacaaattcatccgtgaccacatcgccaaagctgacgcgaaaatcgctgagcaagtgatc
atccagtacggcggttccgtaaacgcagctaacgcggcagaactgttcgctcagccggac
atcgacggcgcgctggttggcggtgcttccctgaaagctgacgcgttcgcggtgatcgtt
aaagcagcggaagcggctaaacaagcttaa

DBGET integrated database retrieval system