KEGG   Citrobacter koseri: CKO_03085Help
Entry
CKO_03085         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cko  Citrobacter koseri
Pathway
cko00010  Glycolysis / Gluconeogenesis
cko00030  Pentose phosphate pathway
cko00051  Fructose and mannose metabolism
cko00052  Galactose metabolism
cko00680  Methane metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
cko01230  Biosynthesis of amino acids
cko03018  RNA degradation
Module
cko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_03085
   00030 Pentose phosphate pathway
    CKO_03085
   00051 Fructose and mannose metabolism
    CKO_03085
   00052 Galactose metabolism
    CKO_03085
  Energy metabolism
   00680 Methane metabolism
    CKO_03085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CKO_03085
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CKO_03085
Protein phosphatases and associated proteins [BR:cko01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CKO_03085
Messenger RNA biogenesis [BR:cko03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CKO_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABV14176
UniProt: A8AL13
Position
complement(2858945..2859907)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENVRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGSYAIELLLEGFGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgcctggcatgaacgcagca
atccgtggtgttgtacgcgcagcgttgacggaaggactggaagtaatgggtatttatgat
ggctacctgggtctgtatgaagaccgtatggttcagctcgaccgttacagcgtgtccgac
atgatcaaccgtggcggtactttcctcggctccgcgcgcttcccggaattccgcgatgaa
aatgttcgcgcagtggctatcgaaaacctgaaaaaacgtggcatcgacgcgctggttgtt
atcggcggtgacggttcctatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccgggcacgatcgacaacgacatcaaaggcactgactacaccatcggttat
ttcaccgcgctgggtacggtagtggaagcgattgaccgtctgcgtgacacctcttcctct
caccagcgtatctccatcgttgaagtgatggggcgttactgcggcgacctgaccctggcg
gcggctatcgctgggggctgtgagtttgttgtggtgccggaagtggaattcagccgtgac
gatctggttgcggaaatcaaagcgggcatcgcgaaaggtaaaaaacacgcgattgtcgcg
atcaccgaacatatgtgtgacgttgatgaactggcgcactacatcgagaaagagactggc
cgtgaaacgcgtgcgaccgtactgggtcacatccagcgtggcggctctccggtgccttac
gaccgtattctggcttcccgtatgggctcatatgccattgaactgctgctggaaggtttt
ggcggacgttgtgtgggcatccagaacgaacaactggttcaccatgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggattgcgctaaaaagctgtac
tga

DBGET integrated database retrieval system