KEGG   Citrobacter koseri: CKO_03104Help
Entry
CKO_03104         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CKO_03104
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_03104
  Lipid metabolism
   00071 Fatty acid degradation
    CKO_03104
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKO_03104
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKO_03104
   00626 Naphthalene degradation
    CKO_03104
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKO_03104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2875003..2876151
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVNLVANKQWGKALVVTDGQLVKLGLLDSLFAALDAHQMS
YHLFDEVFPNPTEELVQKGYAAYQDAQCDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARQVKEVIIDPNIIPDIAVDDASVML
DIPPSVTAATGMDALTHAIEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHAQAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
HVAQAMGVDTQGMSIEAASMEAINAIRALSKRVGIPEGFSTLGVTKDDIEGWLDKALADP
CAPCNPRTASRDDVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcatgttggcacttcccaaaattagcctgcatggcgcaggcgcaatcggcgat
atggttaacctcgtcgcgaacaagcaatggggtaaagcgctggtcgtcactgacgggcaa
ctggtaaaactgggcctgctggacagcctgtttgccgcgcttgacgcgcatcagatgtcg
taccaccttttcgacgaggttttcccgaaccccactgaagaactggtgcaaaaagggtat
gcggcatatcaggacgcgcagtgtgattacatcatcgccttcggcggcggcagcccgatc
gataccgccaaagcggtcaaaattctgacggcgaaccctggcccctctaccgcctattca
ggcgtcggcaaagtcaaaaacgcgggcgttccgctggtggcgattaataccaccgccggt
acggcagcggaaatgaccagcaatgccgtcattatcgactccgcgcgccaggtcaaagag
gtcatcatcgacccgaatatcatccctgatatcgcggtggacgacgccagcgttatgctg
gacatcccgccatccgtcactgccgccaccggcatggatgcgctgacccacgccattgag
gcctatgtctcggttggcgcgcatccgcttaccgacgccaatgcgctggaagccattcgg
ctgattaacctgtggttgccgaaagcggttgatgacggccacaacctcgaagcgcgtgag
cagatggcgtttggccagtatctggcgggtatggcgttcaacagcgctggtcttggtctg
gtacacgcgcaggcgcatcagccaggcgccacgcacaacctgccgcacggcgtctgtaac
gccatcctgctgccgatcattgagaactttaaccgcccgaacgcggtcgcgcgttttgcc
cacgtcgcccaggcgatgggcgtcgatactcaaggtatgagcattgaggcggcgagtatg
gaagcgatcaatgcaatccgcgcattgagcaaacgcgtcggcattcctgaaggtttcagc
acattgggcgtcacgaaagacgatattgaaggctggctggataaagcgctggcagatccg
tgtgcgccgtgtaatccacgcaccgccagccgcgatgacgtccgcgagttgtatctggag
gcgctatga

DBGET integrated database retrieval system