KEGG   Citrobacter koseri: CKO_03227Help
Entry
CKO_03227         CDS       T00592                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cko  Citrobacter koseri
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKO_03227
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CKO_03227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2995752..2996231
Genome map
AA seq 159 aa AA seqDB search
MTVAYIALGSNLASPLEQVNAAVKAIGDIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LETQLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDDVINTPRLTIPHYDMK
NRGFMLWPLFEIAPDLVFPDGVTLHHYLTRLAAEKPAYW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacggttgcctatatcgcgctcggcagcaacttagcctctccgctggagcaggttaat
gctgccgtgaaggctatcggcgacatcccggacagccgtattgttgccgtttcctcgttt
taccgcactcccccgctaggcccgcaggatcagccggactacctgaacgccgccgttgcg
ctggaaacccaactggcgccggaagaactgctcaaccacacgcagcgtattgagttacaa
cagggccgcgttcgcaaagccgaacgctgggggccgcgcacgctcgatctcgacatcatg
ctgtttggtgatgacgtaataaacacgccccgcctgacgataccgcactacgacatgaaa
aatcgcggttttatgctgtggccgctctttgaaatcgcccccgacctggtgttcccggac
ggcgttacgctgcatcattacctcacacgcctcgcagcagaaaaacctgcctactggtaa

DBGET integrated database retrieval system