KEGG   Citrobacter koseri: CKO_03289Help
Entry
CKO_03289         CDS       T00592                                 

Gene name
murF
Definition
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
cko  Citrobacter koseri
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CKO_03289 (murF)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKO_03289 (murF)
Enzymes [BR:cko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     CKO_03289 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3058394..3059752)
Genome map
AA seq 452 aa AA seqDB search
MISVTLSQLAGILHGELQGADLTIDAVTTDTRKVTPGCLFVALKGERFDAHDFADNAKEG
GAGALLVSRPLDCDLPQLIVKDTRLAFGELAAWVRAQVPARVVALTGSSGKTSVKEMTAA
ILSQCGNTLYTAGNLNNDIGVPMTLLRLNNDYDYAVIELGANHQGEIAWTVGLTRPEAAL
VNNLAAAHLEGFGSLAGVAKAKGEIYTGLPVNGIAIMNADNNDWLNWQGIIGDRKVWRFS
PNAANSDFTATNIHVTSHGTEFTLQTPTGDIDVLLPLPGRHNIANALAAAALSMAVGATL
DAIKTGLANLKAVPGRLFPIQLNDNQLLLDDSYNANVGSMTAAVQVLSEMPGYRVLVVGD
MAELGAESEACHVQVGEAAKAAGIDSVLSTGKLSQAIGNASGVGEHFADKSALVARLNTL
IAEHQIITILVKGSRSAAMEEVVRALQENGTC
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgtaacgctcagccaactggccggtattctgcacggcgaattacagggcgca
gacctgacgattgacgcggtcacgactgatacgcgtaaagtgacgccgggctgcctgttt
gtggcgctgaaaggcgagcgtttcgacgcccatgattttgcggataacgcgaaagagggc
ggcgccggtgcgctgctggtgagtcgcccgctggattgcgatctgccgcagctgatcgtc
aaagatacgcggctggccttcggcgaactggccgcatgggttcgggcgcaggttcccgct
cgcgtcgtggcgttaaccggctcctccggcaaaacatccgttaaagagatgaccgccgcc
attctgagtcagtgtggcaacaccttatacaccgcgggcaacctgaataacgatatcggc
gtaccgatgacgttgctgcggttaaacaacgattatgactatgccgtcattgagttaggc
gccaatcaccagggcgaaattgcctggaccgtcggcctgacgcgtcctgaagcggcactg
gttaataatctggcggcagcgcacctggaaggattcggttcgctggcgggcgtggcgaaa
gcgaaaggcgaaatctataccggcttgccggtgaatgggatcgccattatgaacgccgat
aacaacgactggctgaactggcagggcattattggcgatcgcaaagtgtggcgtttttca
ccgaatgccgccaacagcgattttaccgcgaccaatatccatgtgacctcgcacggtacg
gaattcacgctgcaaacgccgacgggcgacattgacgtcctgctgccgcttcctggtcgt
cacaatattgcaaacgcgctggcggcggctgcgctgtcgatggcggtaggggcgaccctt
gacgccattaaaaccggtctggcgaacctgaaagccgtgccggggcgcctgttccccatc
cagttgaatgacaaccagctgttacttgatgactcctataacgccaacgtcggttcgatg
accgccgctgtgcaggtgctgtctgaaatgccaggctaccgggtgctggtggttggcgat
atggcggagctgggcgcggaaagcgaagcatgccatgttcaggtcggtgaagcggcaaaa
gcggcgggtatcgacagcgtgctgagtacaggaaaactgagtcaggcgatcggcaatgcc
agcggcgttggcgaacattttgcggataaatcggctctggtcgcgcgtcttaacacgctg
attgcggagcatcagattattaccattttagtgaagggttcacgtagtgccgccatggaa
gaggtagtacgcgcattacaggagaatggaacatgttag

DBGET integrated database retrieval system