KEGG   Citrobacter koseri: CKO_03409Help
Entry
CKO_03409         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cko  Citrobacter koseri
Pathway
cko00240  Pyrimidine metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CKO_03409
Enzymes [BR:cko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CKO_03409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABV14492
UniProt: A8ALX9
Position
complement(3179623..3180978)
Genome map
AA seq 451 aa AA seqDB search
MAFYSFPLGVTVFLAQEIIRKKRDGHPLSDEEIRFFINGIRDNTISEGQIAALAMTIFFH
DMSMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYI
PMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYA
TRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVSN
GAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKL
AKDDADARVKLQAVLDNGKAAEIFGRMVAAQKGPSDFVENYAKYLPTAMLSKAVYADTEG
FVSAMDTRALGMAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDEAS
WQEAAKAVKAAISLDDKAPEITPTVYRRITE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggccttctactcttttcccctgggggttaccgtgtttctcgcacaagaaattattcgt
aaaaaacgtgatggtcatccgttaagcgacgaagagatccgcttctttatcaatggtatt
cgtgataacaccatctctgaagggcagattgccgctctggcgatgaccattttcttccac
gatatgtcgatgcctgaacgtgtgtcgctgaccatggcgatgcgagattcaggaaccgtt
ctggactggaagagtctcaaccttaacggccccattgttgacaaacactccaccggcggc
gtgggtgatgtgacttcgctgatgcttggccctatggtggcggcctgcggcggctacatt
ccgatgatctccgggcgcggcctcggtcataccggcggtacgctcgataaactggaagca
atcccgggatttgatattttcccggacgacaaccgtttccgcgaaatcattaaagacgtg
ggtgtggcgattattgggcagaccagttcgctcgcaccggcggataaacgtttttacgcc
acccgcgacattaccgcgacggtggactccatcccgctgatcaccgcttcaatcctcgcg
aaaaaactggcggaagggctggatgcactggtgatggacgtgaaagtgggcagcggcgcc
tttatgccgacctacgaactctctgccgcgctggctgaagccatcgttggcgtttccaac
ggcgcgggcgtgcgcacaactgcgctgctcaccgacatgaatcaggtgctggcctccagc
gccggtaacgccgtcgaagtgcgcgaagcggtgcagttcctgaccggtgaataccgcaac
ccgcgtctgttcgacgtcacgatggcgctgtgcgtggagatgctgatctccggcaaactg
gcgaaagatgacgctgatgcgcgagtgaaactacaggcggtgctggataacggcaaagcg
gcggaaatctttggtcgcatggtagcggcacagaaagggccgagcgatttcgtggaaaac
tacgcgaaatacctgccgacggcgatgctcagcaaagctgtctatgccgatactgaaggt
tttgtatccgcgatggacactcgcgcgttgggcatggcggtggtctcaatgggcggcggt
cgtcgccaggcgtcggacaccattgattacagcgtcggctttaccgacatggcgcgtctg
ggcgacagcgttgacgggcagcgtccgttggctgttatccacgccaaagacgaagccagc
tggcaggaagcggcgaaagccgtcaaagcggcaatcagccttgacgacaaagcgcctgaa
attacaccgacagtctatcgtcgtattaccgaatag

DBGET integrated database retrieval system