KEGG   Citrobacter koseri: CKO_03578Help
Entry
CKO_03578         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cko  Citrobacter koseri
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKO_03578
Enzymes [BR:cko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CKO_03578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3332055..3333764
Genome map
AA seq 569 aa AA seqDB search
MSQNAHHTFIKNTLAQLYPHADRYALAAKIEQLCQRWKLREQITAPLDQSRVWMIAYGDS
IHSGDANALACLHQFSTRWLKGVISDIHLLPMFPWTSDDGFSVKDYRHIAPELGQWSDIA
ALAGDFNLMFDFVINHISQQSRWFQGYLHGEPRYQHYFISADPDDDYHLVTRPRALPLLT
PFKRKTGETVHIWTTFSADQIDLNFREPDVLLESIDILLEYAARGARAIRLDAIGFLWKE
RNSTCIHLPQTHLIVKLWRAILDATWPDCLLITETNVPHQENISYFGNGDEAHMVYQFPL
PPLTLHAFLRGNARWLRQWAQRLEQDAFPDKTTFFNFLASHDGIGLRPVENLLCAEERQF
LISEVERKQGRISWKTNPDGSQSPYELNINFLSALSEPGESPDDQLARFTAAHAILFMLR
GVPAIYYHSLFGSENDNTGLLESGINRRINREKLDAATLHEQLLSPETRQSRIYASLAKL
ARIRQQHPAFSPFASQHVPELPDALFGVVRQHPTKGETLYCVVNVTGIPQSLSLPVTGTD
LLTGAAFNGACELSGWQTVWILADTQPEA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacgcccatcataccttcatcaaaaacacgttagctcagctttatccccat
gcggatcggtacgcgctggcggcgaaaatcgagcaactctgtcaacgctggaagctacga
gagcaaatcaccgcgcctttggatcagagccgggtgtggatgattgcttatggcgacagt
atccatagcggggacgcaaacgctcttgcctgcctgcatcagttttcgacacgctggctt
aagggcgtcatcagcgacattcacctgctgcccatgttcccgtggacatctgatgatggc
ttcagcgttaaagattatcgccacattgcgccagagttaggccagtggtcagacattgca
gcgctggcaggcgattttaatctgatgtttgatttcgtgattaaccatatctctcagcaa
agccgctggttccagggctatttacacggcgaaccgcgttatcagcactactttattagc
gccgaccctgacgatgactaccatcttgtcacgcgtccacgcgcccttcccctgcttacg
ccattcaagcgcaaaacgggggaaaccgtacatatctggacgacattcagcgccgatcag
atcgatctgaatttccgtgaacctgacgtgttactggaaagtatcgacatcctgctggaa
tacgcagcgcgcggcgcgcgcgcaatcaggctcgatgcgatcggttttttgtggaaagag
cgaaacagcacctgtattcacctgccgcagacgcatctgatcgttaaactctggcgcgcc
attctggatgcaacctggcctgactgcctgttgattacggaaaccaacgtcccgcatcag
gaaaatatcagctacttcggcaacggcgatgaagctcacatggtgtatcagttccccttg
ccgccgctgacgctccatgcctttttacgcggtaacgcacgctggttacgccagtgggcg
caacgtctggaacaggatgcgtttcccgacaagacgaccttttttaatttcctcgccagc
cacgacggcatcgggctgcgtcccgtggaaaatctcctttgcgcagaagagcggcagttt
ctgataagcgaggtagaacgcaagcaggggcgtatttcatggaaaaccaaccctgacggc
agccagtcgccgtatgaacttaacatcaactttctgagcgcattgagcgagccaggggaa
agtcccgacgaccagctcgccagattcaccgccgcgcacgccatcctctttatgctgcgg
ggcgtgcctgcaatctattatcacagcctcttcggcagtgaaaatgacaacaccgggctg
ctcgaatcgggcataaatcgccgcattaaccgggaaaaactggacgctgccacgctccat
gagcagttgctctcgccggaaacgagacaatcccgaatctacgcgtctctggcgaagtta
gcgcgtatacgccagcagcatcccgcattttctccgttcgcctcgcagcacgttcctgaa
ttgcctgacgcgctctttggcgtcgttcgccagcatcctacaaaaggcgaaacgctgtac
tgcgtcgtgaacgtcacaggaataccacaatcactttcactgcctgtcacaggaacagat
ctgctgacgggcgcagcattcaacggcgcttgcgagctttccggctggcaaacggtatgg
attctcgctgatacgcaaccggaggcataa

DBGET integrated database retrieval system