KEGG   Citrobacter koseri: CKO_03816Help
Entry
CKO_03816         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cko  Citrobacter koseri
Pathway
cko00010  Glycolysis / Gluconeogenesis
cko00620  Pyruvate metabolism
cko00640  Propanoate metabolism
cko00680  Methane metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_03816
   00620 Pyruvate metabolism
    CKO_03816
   00640 Propanoate metabolism
    CKO_03816
  Energy metabolism
   00680 Methane metabolism
    CKO_03816
Enzymes [BR:cko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CKO_03816
Lipid biosynthesis proteins [BR:cko01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CKO_03816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABV14892
UniProt: A8AN29
Position
3543185..3545143
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHAIPANIADRCLINPEQYEAKYQQSINEPDTFWGEQGKILDWITPYKKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDATQSKHISYRELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRGIPLKKNVDDALKNPNVNSVEHVVVLKRTGGKVDWHEGRDLWWSDV
IEKSSADHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPDDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVTILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEDPSPELYTEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacacgctattcccgcaaacattgcggatcgttgcctgataaac
ccggagcagtatgaggcgaaatatcaacaatctattaacgagccagataccttttggggt
gaacagggaaagattctcgactggattacaccgtataaaaaagtgaagaacacctccttt
gcgcccggcaacgtgtcgattaaatggtatgaggatggcacgctgaacctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgaccgtaccgccatcatctgggaaggcgat
gacgccacccagagcaaacacatttcatatcgcgaattgcatcgcgatgtttgtcgtttc
gccaatacgctgctggagctgggcattaagaaaggcgacgtcgtggctatttatatgccg
atggtgccggaggcggcggtggcgatgctggcctgcgcgcgcattggcgcggtgcattcg
gtgatcttcggcggcttctcgccggaagcggttgccgggcgaatcatcgactccagctca
cgtctggtgatcaccgccgatgaaggcgtgcgtgccggacgcggcatcccgctgaaaaag
aacgtcgatgatgcgctgaaaaacccgaatgtgaacagcgttgaacatgtggtggtttta
aaacgtactggcgggaaagtcgactggcatgaaggccgcgatctgtggtggagcgacgtg
attgagaaatccagcgctgaccatcagccggaagagatgaatgcggaagacccactgttt
atcctctacacctccggttcaaccggcaagccaaaaggcgtgctgcataccaccggcggc
tatctggtctatgccgccaccacctttaagtatgtctttgactatcacccggacgatatc
tactggtgcaccgcagacgtaggttgggtgaccgggcacagctacctgctgtatgggccg
ctggcctgcggcgcaaccaccctgatgtttgaaggcgtgccaaactggccgacgcctgcg
cggatggcgcaggtggtggataagcaccaggttactattctctacaccgccccaaccgct
attcgcgctctgatggcggaaggcgataaggcgattgaaggcaccgatcgctcttcgctg
cgcatcctcggttccgtcggcgaaccaatcaacccggaagcgtgggaatggtactggaag
aagatcggtaacgaaaaatgcccggtagtggacacctggtggcagaccgaaaccggcgga
ttcatgatcacgccgctgcccggcgcgactgaactgaaagccggttccgccacgcgtccg
ttctttggcgtgcagcccgcgctggtggataacgaaggccacccgcaggaaggggcgacc
gaaggcaatctggtgattaccgactcctggccgggtcaggcgcgtaccctgttcggcgat
cacgagcgttttgagcagacctacttctctaccttcaaaaacatgtatttcagcggcgac
ggcgcgcgtcgtgacgaagatggttactactggatcaccgggcgcgtcgatgacgtactg
aacgtttccggccatcgtctgggcacggcggagattgaatccgcgctggtgtcgcatccg
aagattgccgaagccgcagtggtcggtattccgcacaacatcaaaggccaggccatctac
gcctatgtcacgctgaatcacggcgaagatccgtcgccggagctgtataccgaagtacgc
aactgggtacgtaaagaaattggcccgctggcaacaccggacgtgctgcactggacagac
tcactgccgaaaacgcgttccggcaaaatcatgcgccgtattttgcgcaaaatcgcagcg
ggcgataccagcaatctgggcgatacctcaaccctcgccgatcctggcgtggtcgagaaa
ctgctcgaagagaagcaggccatcgcaatgccttcataa

DBGET integrated database retrieval system