KEGG   Citrobacter koseri: CKO_03851Help
Entry
CKO_03851         CDS       T00592                                 

Definition
(RefSeq) hypothetical protein
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cko  Citrobacter koseri
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_03851
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKO_03851
   00640 Propanoate metabolism
    CKO_03851
   00660 C5-Branched dibasic acid metabolism
    CKO_03851
Enzymes [BR:cko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CKO_03851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3582495..3583664)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQHITELPEAWRTISSENKGAVLKAQVHAGGRGKAG
GVKVLTQFSQAETFAVQMLGSQLVTYQTGSEGQYVSRILVCENIYPVRQELYFGVVVDRE
SQRVTFIVSSEGGVEIEKVAHDTPEKIDKVSVDPLTGIQPCHVRELFAVLGLEKTLYSGF
SQLVNQAWKAFNELDFALLEINPLVICENGEFMCADAKVTLDDNALYRHPELQALRDETQ
EDERENQAAKLDLNYVALDGAIGCMVNGAGLAMATMDIIKLYGAQPANFLDVGGGATQER
VSEAFRLIVSDKKVQGILVNIFGGIVRCDMIARAIIHALHEEQITLPVVVRLSGNHATEG
QRLLAESGLAVEAVDSLDDAAKRIIALLK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggctaaatcattactggccggtatgggtatgccatgcccg
aaagagatagcgattcaacatattactgagttgccggaagcctggcgcactatttccagt
gaaaacaaaggcgcggtgctgaaagcccaggtacatgctggtggacgtgggaaagctggc
ggcgtgaaggtgctcacgcagttttcgcaggcggaaacgttcgccgtacagatgctgggt
tcgcaactggtgacctaccagaccgggtcggaaggtcagtatgtcagccgcattctggtg
tgcgaaaacatctatccggtacgtcaggaactctattttggcgtagtggttgatcgcgaa
agccagcgcgtcacgtttattgtcagttctgaaggcggtgtggagattgaaaaggtcgca
catgacacgccggaaaagatcgataaagtgagcgtcgatccgcttactggcattcagcct
tgccatgtgcgtgagttgtttgcggtgctgggactggagaaaacgttgtattccgggttc
agccaattggtgaatcaggcatggaaggcgtttaacgaactcgattttgcgctgctggag
attaatccgctggtgatctgtgaaaatggcgagtttatgtgcgccgacgcaaaagttacc
ctggatgataacgcattgtatcgtcaccctgaattacaggcgttacgcgatgaaacgcag
gaagatgagcgggaaaaccaggcggcgaaactcgaccttaactatgttgcgttggatggc
gctatcggctgtatggttaatggtgccgggctggcgatggcgacaatggacattataaaa
ctctatggcgcgcaacccgccaactttcttgacgttggtggtggtgcgacgcaggaacgg
gtcagtgaagcatttcgcctgattgtctccgataaaaaagtacagggaattctggtcaat
attttcggcggcatcgtgcgttgcgacatgattgctcgcgccattatccacgcgctgcat
gaagaacaaattaccctgccggtagtggtgcgtctgtccggcaaccatgcgactgaaggg
cagcgtttgttggcggaaagtggtctcgcggtagaagccgttgattctctcgatgatgcc
gcgaagcgcatcatcgcattgctgaaatga

DBGET integrated database retrieval system