KEGG   Citrobacter koseri: CKO_03853Help
Entry
CKO_03853         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cko  Citrobacter koseri
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_03853
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKO_03853
  Amino acid metabolism
   00310 Lysine degradation
    CKO_03853
Enzymes [BR:cko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKO_03853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3585178..3586341)
Genome map
AA seq 387 aa AA seqDB search
MIEITVPQLPESVTEGTLTAWCKNEGDFVRRDEVVAELETDKVILEIPAPQDGLLAKIMV
SEGSSVVSAQRLAQLTPQAAGTESAATSVEPPAAMPAARLEAQRSDVDLAAVTGSGRQGR
ILKEDVLQHAQSVAPATAPVVPAPVMPRRPTSMGAREERREPMSRLRLRIAERLLASQRD
NAILTTFNEVNMQNVMDLRARWKDRFAEKHGVKLGFMSFFVKAVTRALERFPIVNASVDG
NDILWHDYCDIGIAVSSNRGLVVPVLRDAQTLSLVEIERQIADYAALARAGKLPLEALQG
GTFSVTNGGTFGSMMSTPIINPPQSAILGMHAITPRPVVEKGQVVIRPMMYLALSYDHRI
IDGQEAVQTLVAIRELLEAPEQLLLDL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattactgtccctcaactaccggaatcagtgacggaaggcacgctgacggca
tggtgtaaaaacgaaggtgatttcgtgcgtcgcgacgaggtggtggcggaactggaaacc
gataaagtgatcctcgaaatccccgcgccgcaggacggcttgctggcaaagattatggtc
agcgaaggcagttccgtagtttccgcgcagcgactggcgcaactgacgccgcaggcggcg
ggtacggaatcagccgctacatctgtcgaaccgcccgccgccatgcctgccgctcggctt
gaagcgcaacgcagcgatgtggatcttgctgctgtgaccggaagcggacgtcagggacgt
attctgaaagaggatgtattgcaacatgcgcaatctgttgccccggcaaccgcgccagtg
gttccagccccggtgatgccacgtcggcccacgtcaatgggggctcgcgaggagcgccgt
gagccgatgtctcgtttacgcttgcgtatcgctgagcgtttgctggcttcacagcgggat
aatgccattctgacgaccttcaacgaagtcaacatgcagaatgtgatggatctgcgtgct
cgctggaaggatcgttttgcggaaaaacatggcgtgaagctgggctttatgtcgttcttt
gtcaaagctgtcacccgcgcgcttgagcgtttcccgatagtcaatgccagcgtagacggc
aacgatattctctggcacgactactgcgatattggcattgcggtgagcagcaatcgcggc
ctggttgtgccggtactgcgcgatgcgcaaactttatcactggttgaaatcgaacggcaa
atcgctgattacgccgcgctggcgcgtgccggaaaactgccgctggaagcgttacagggc
ggtacgttttctgtcaccaacggcggtacgtttggctcaatgatgtccacgcccatcatc
aacccaccgcagtccgccattctcggtatgcacgccattacaccgcgtccggtagtggaa
aagggtcaggtggtgatccgcccaatgatgtatctcgcgctgagttacgaccatcgcatt
attgatggccaagaagcggtacagacgctggttgcaatccgcgaactgctggaagcaccg
gaacagctgttgctggacctgtaa

DBGET integrated database retrieval system