KEGG   Citrobacter koseri: CKO_03905Help
Entry
CKO_03905         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cko  Citrobacter koseri
Pathway
cko00630  Glyoxylate and dicarboxylate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01200  Carbon metabolism
Module
cko_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CKO_03905
Enzymes [BR:cko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CKO_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABV14981
UniProt: A8ANB8
Position
complement(3636532..3637851)
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQLGAAKMWR
LLHGDAKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWASGIEPGDPRFVDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLIARTDA
DAADLITSDCDAYDSEFITGERTSEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDL
ELAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHSYAQGEGMRHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagagttacagaaagaatgg
acgcaaccgcgctgggaaggtatccgtcgcccgtatagcgcggaggaagtggtgaaatta
cgcggctcggtcaacccggaatgtacgctggcgcagcttggcgcggccaaaatgtggcgt
ctgctgcatggcgacgcgaaaaaaggctacatcaacagcctcggcgcactgactggcggc
caggcgttgcaacaggcgaaagcgggcattgaggcggtctatctgtccggctggcaggtg
gcggcggacgctaacctggcctccagcatgtacccggatcaatcgctgtacccggcaaac
tctgttccggcggtcgtggatcggatcaacaacactttccgtcgtgcggatcagatccag
tgggcgtccggcattgagcctggcgatccgcgctttgtcgattacttcctgccgatcgtt
gccgatgcggaggccggttttggcggcgtactgaacgcgtttgaactgatgaaatcgatg
atcgaagccggtgcagcggctgttcacttcgaagatcagcttgcatcggtgaagaagtgc
ggtcatatgggcggcaaagttctggtgccgacgcaggaagccattcagaaactggtggct
gcgcgtctggcggctgacgtgatgggcgtaccgacgttgctgattgcccgtaccgacgcg
gatgcggcagatctgataacctccgactgcgacgcgtacgacagtgaatttattaccggc
gaacgcaccagcgaaggcttcttccgcacgcgtgccggtattgagcaggcgatcagccgt
gggctggcgtatgcgccttacgcagacctggtgtggtgcgaaacctccacgccggacctt
gaactggcgaagcgctttgccgatgccatccatgcgaaatacccgggtaaactgctggcc
tacaactgctcgccgtcgtttaactggcagaagaacctggacgataaaaccatcgccagc
ttccagcagcagctgtcggacatgggctacaagtaccagttcatcaccctggcgggcatc
cacagcatgtggttcaacatgttcgatctggcacattcctatgcgcagggtgaaggcatg
cgccactacgttgagaaggttcagcagccagaatttgcggcggccaaagacggttacacc
ttcgtgtcccatcagcaggaagtggggacaggctacttcgacaaagtgaccaccattatt
cagggtggcacctcctcagtgacggcattaacgggttccactgaagaatcgcagttctga

DBGET integrated database retrieval system