KEGG   Citrobacter koseri: CKO_03906Help
Entry
CKO_03906         CDS       T00592                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cko  Citrobacter koseri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKO_03906
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKO_03906
   00630 Glyoxylate and dicarboxylate metabolism
    CKO_03906
Enzymes [BR:cko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CKO_03906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3637868..3639469)
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDELTFTRPHGEQEKQILTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDD
GKLPDFISETASIREGDWKIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPALLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKALEANNG
HDGTWIAHPGLADTAMTVFNEALGENQNQLFVTRDEDAPITAEQLLAPCEGDRTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
QMLAEEMLVIQDELGEHRFSSGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacgacaaccgatgaactgacctttaccaggccgcatggtgagcag
gagaagcaaattctgaccgcagaagcggtagagtttctgaccgaactggtgacgcgtttt
acgccaaagcgtaacaaactcctcgctgctcgtattcagcaacagcaggatattgatgac
ggtaagttgcctgattttatttcggaaaccgcttccattcgtgagggtgactggaaaatt
cgcggcattcctgacgatttacaggatcgtcgcgtggaaatcaccggcccggtagaacgt
aaaatggtgattaacgcgctgaatgctaacgtgaaagtgttcatggctgactttgaggat
tcactggcgccggagtggagcaaagtgattgatggtcagatcaacctgcgtgatgcggtg
aacggcaccatcagctacaccaacgaagccgggaaaatctatcaactcaagccggacccg
gcgttactgatttgtcgcgtacgcggtttacacctgccggaaaaacatgtgacctggcgt
ggtgaagccattcctggcagcctgtttgatttcgctctctactttttccacaactataaa
gcgttgctggcaaaaggcagtggcccgtatttctacctgccgaaaactcaagcctggcag
gaagccgcctggtggagcgaagtcttcagctatgccgaagaccgttttaatctgccgcgt
ggcaccatcaaagccaccttgctgattgaaacgctgcctgccgtcttccagatggatgag
atcctgcacgcgctgcgtgaccatattgttggtcttaactgcggccgctgggattacatt
ttcagctatatcaaaacactgaaaaatcacccggatcgcgtcctgccggaccgtcaggtg
gtgacgatggataaaccgttcctcagcgcctattcacggctgttgatcaaaacctgccac
aagcgcggcgcatttgcgatgggcggcatggcggcgtttatcccgagcaaagacgccgag
cgcaacaatcaagtgctcaacaaagtgaaagcggacaaagcgctggaagccaataacggt
catgacggcacctggatcgcgcacccggggctggcggacaccgcgatgacggtctttaac
gaggcgctgggcgaaaaccagaaccagctgtttgttacccgtgatgaagatgcgcccatt
actgccgaacagctgctggcgccctgcgagggcgatcgtaccgaagaggggatgcgtgcc
aatattcgcgtggcggtgcagtacatcgaagcatggatttccggtaatggctgcgtaccg
atttatggcctgatggaagatgcggcaacggctgaaatctcccgtacctctatctggcaa
tggattcatcacgagaaaaccctgagtaacggcaaacccgtcacgaaagcgctattccgc
cagatgctggccgaagagatgctggtgatccaggacgagctgggagagcaccgcttcagc
agcgggcgctttgatgaagccgcgcgcctgatggagcagatcactacctctgatgaactg
atcgatttcttgaccctgccaggctaccgcctgctggcttaa

DBGET integrated database retrieval system