KEGG   Citrobacter koseri: CKO_03973Help
Entry
CKO_03973         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cko  Citrobacter koseri
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CKO_03973
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CKO_03973
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CKO_03973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3695978..3696520
Genome map
AA seq 180 aa AA seqDB search
MSALTIYSDKDASQPQWHSTDAAEIAQQLNAKGVRFERWVADRDLGQAPAPETVITAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALRAKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
QVYQVLCEKNDLISVPAGTPHWFDMGSEPNFTAIRIFDNPEGWVAQFTGDAIADAYPRLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattgactatttattccgataaagacgccagccagccccagtggcacagtacc
gacgccgcagagatagcccaacagctcaacgcgaaaggcgtccgcttcgaacgctgggtt
gcagaccgcgacttaggccaggcccccgcgccagaaacggtgatcaccgcctatcaacat
gcgattgataagctggttgccgagaaaggctatcagagctgggatgtgatcagcctgcgc
gccgacaatccacaaaaagaggcgctgcgtgcaaagtttctcaatgaacacacccacggc
gaagatgaagtgcgattcttcgttgaaggcgcaggactgttttgcctgcacattggcgac
caggtttaccaggtgctgtgtgagaaaaacgatctgatttcagtgcccgccggtacgccg
cactggtttgatatgggctccgagccaaactttaccgcgatccgtattttcgataacccg
gaaggctgggtggcgcagtttaccggcgacgccattgcggatgcctatccgcgcctgctt
taa

DBGET integrated database retrieval system