KEGG   Citrobacter koseri: CKO_04159Help
Entry
CKO_04159         CDS       T00592                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cko  Citrobacter koseri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CKO_04159
Enzymes [BR:cko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CKO_04159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3867980..3868627)
Genome map
AA seq 215 aa AA seqDB search
MERNTLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYDKLTESHIVFIDA
EGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEYVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaacacactggcccgccagattatcgacacctgcctggagatgacccggctg
gggctgaaccaggggaccgcaggcaatgtgagcgtgcgttatcagggcgggatgctgatc
acgccaacgggcattccgtatgacaaactcaccgaatcacatatcgtctttattgatgca
gagggtcagcatgagcagggaaaattgccttccagcgagtggcgtttccatatggcggcc
taccagacgcgcccggatgctaacgctgtcgtccataaccatgccgttcactgcacggcg
gtgtcgatcctcaatcgtcctattccagccattcattacatgattgcggcggcggggggg
aactccattccgtgtgcgccttacgccacgttcggcacgcgtgaactttctgaatacgtt
gccgttgcgctcaaaaatcgcaaagcgaccctgctacagcatcatgggttgatcgcctgc
gaagagaacctggaaaaagcgctgtggctggcgcatgaagtggaagtgctggcgcagctg
tacctcagtacgctggcgattaccgatccggtgcctgtactggatgatgaggctatcgcc
attgtgctggaaaaattcaaaacctacggattacgtatcgaagagtaa

DBGET integrated database retrieval system