KEGG   Citrobacter koseri: CKO_04161Help
Entry
CKO_04161         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
cko  Citrobacter koseri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CKO_04161
Enzymes [BR:cko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     CKO_04161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3870525..3872300
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALITEKLRHACGAQIECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNAQQYKRNEEQSRAVLKESLLMAMCIRDMMQGNNKLAEKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLLGHQLTGTAQVFA
DVRTYWSPEAVERVTGQPLTGLAEHGIIHLINSGSAALDGSCKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKEMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVDDAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaattggcattcgcccggttattgatggacgtcgcatg
ggggtacgcgagtcgctggaagaacagaccatgaatatggcgaaagccaccgctgcgctt
atcaccgaaaaactccgccatgcctgcggcgcgcagattgaatgtgtgattgcggatacc
tgcattgccggaatggcggaatccgccgcctgtgaagagaaattcagcagccagaatgtt
ggcgtaaccattaccgtgacgccgtgctggtgctacggcagcgaaaccatcgatatggac
ccaatgcgcccgaaagccatctggggcttcaacggtacggaacgtcccggcgccgtttat
ctggccgccgcgttggccgcgcacagccagaaaggcattccggcattctctatttatggt
catgacgtacaggatgccgacgacacctcgatccctgccgacgttgaagaaaaactgttg
cgctttgcgcgcgctggtctggcggtcgccagcatgaaaggcaaaagctacctctctgtg
ggcggcgtctcaatggggattgccggttccatcgtcgatcacaacttctttgagtcctgg
ctggggatgaaagtgcaggcggtggacatgaccgagctgcgccgtcgcatcgaccagaaa
atctatgacgaagccgagctggagatggcgctggcgtgggcggataaaaacttccgctat
ggcgaggatcagaacgcgcagcagtacaaacgtaatgaagaacaaagccgcgcggtgctg
aaagagagtctgctgatggcgatgtgcattcgcgacatgatgcagggcaacaacaagctg
gcggaaaaagggctggtcgaagagtcgctgggttataacgctattgcggcaggcttccag
ggccagcgccactggaccgatcaatacccgaacggcgacaccgccgaagcgctgctgaac
agctcctttgactggaacggcgtgcgcgaaccgtttgtcgtcgctaccgaaaacgacagc
ctcaacggcgtagcgatgctgctgggccaccagctcaccggaaccgcgcaggtctttgcc
gacgtgcgaacctactggtcgccggaagcggtagagcgcgtcacaggccagccgctcacc
ggccttgcggagcacggcatcattcacctgatcaactccggctctgcggcgctggacggc
tcctgcaaacagcgcgatagcgaaggcaaaccgaccatgaagccgcactgggaaatcagc
caacaggaagcggacgcctgcctggccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggctactcctctcgcttcctgaccgaaggcggcgtgccgttcaccatg
acccgcgtgaacatcatcaagggtctggggccggtactgcaaatcgctgaaggctggagc
gtggaactgccgaaagagatgcacgatcagctcgacgcccgcaccaactcgacctggccg
accacctggtttgcgccgcgtcttaccggtaaaggcccgttcaccgacgtttactcggtg
atggcgaactggggcgctaaccacggcgtactgaccatcggccacgtcggcgctgacttc
atcacgctcgccgccatgctgcgtattccggtctgcatgcacaacgtggacgatgcgaaa
atctaccgtccttccgcctgggctgcgcacggtatggatattgaaggccaggattatcgc
gcctgccagaactacgggccgctgtacaaacgttaa

DBGET integrated database retrieval system