KEGG   Citrobacter koseri: CKO_04184Help
Entry
CKO_04184         CDS       T00592                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cko  Citrobacter koseri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKO_04184 (recD)
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CKO_04184 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3885809..3887635)
Genome map
AA seq 608 aa AA seqDB search
MTIQKRLLEAVEQKLLRPLDAQFALAVAGQDDPCVTLAVALLSRDAGEGHVCMPLSRLAI
TEESHPLLVSWFSERDVPEDWASCLLASGAVSRGERPTPLILHEDRLYLNRMWSNERTVA
RFFSEVNQAIAVDEQQLARTLDALFPPTDDVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDEQKKRIPDDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIEALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAWVNAGFTAGRAQQLSRLTGSPIPAGAGTEAASLRDSLCLLQKSYR
FGHDSGIGQLAAAINCGDKAAMKTVFQQGFSDIEKRTLQSSEDYAAMLDEALAGYGRYLA
LVREGAEPGAIIQAFNEYQLLCALREGPFGVGGLNERIEQVMLQKRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFAMPDGSIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERVLSGAIATRTERRSGL
SAFFNNGL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcagaagcggttactggaggccgtagaacaaaagttgttgcggccattagac
gcgcagtttgcgctggcggttgccgggcaggacgatccgtgcgtaacgctggccgttgca
ttgctcagccgcgatgccggggaagggcatgtctgtatgccgctttcgcgtctggcgata
acggaagagtcgcatccgctactggtctcctggtttagcgagagggatgtgcctgaagac
tgggcatcgtgtctgctggcttccggggcggtcagtcggggagagcggccaacgccgttg
attctgcatgaagatcgcctttacctgaaccggatgtggagtaacgagcgcacggtagcc
cgcttttttagcgaggttaaccaggcgatcgcggtagatgaacagcaactggcccgcacg
ctggatgcgcttttcccgccgacggatgatgtcaactggcaaaaagtggcggcggccgtg
gcgttgacgcgccgtatttccgtcatttccggcgggcctggcaccggtaaaaccactacc
gtggcgaagctgctggccgcgttgattcagatggcggacggcgaacgatgccgtatacga
ctggcggcgccgacggggaaagcggcggcgcgtctgaccgagtcgcttggcgcggcattg
cgccagcttccgctcacggatgagcaaaaaaaacgcatcccggatgacgccagtacgttg
caccggctgttgggcgcacagcccggtagccagaggctgcgccatcatgcgggaaacccg
ctgcatctggacgtgctggtggtggatgaggcatcaatgatcgatttgccgatgatgtcg
cggctaattgaggcgctgccgccgcacggacgcgtgatttttctcggcgatcgcgatcag
ctggcttccgttgaggcgggggcggtgctgggcgatatctgcgcctgggtaaatgccgga
tttaccgccgggcgcgcgcagcagctgagccgattgacgggaagccccattcctgcgggc
gcaggcacggaggcagcctctttgcgcgatagcctgtgtttgctgcaaaaaagctatcgc
ttcgggcatgattccggcattggtcaactggcggcagccattaattgcggcgataaagcg
gcgatgaaaacggtctttcagcagggattcagcgatattgaaaaacgaacgctacagagc
agcgaggattacgccgccatgctcgacgaggcgctggccggttatgggcgttatctggcg
cttgttcgcgagggcgcggagccgggggcgattattcaggctttcaatgagtaccagttg
ctgtgcgcgctgcgtgaagggccgtttggcgttggcggtctgaatgaacgcatcgaacag
gttatgctgcaaaagcgcaaaattcagcgtcacccgcacagccgctggtatgaagggcgt
ccggtaatgattgcgcgtaatgacagcgcgttggggttgttcaatggcgatatcggcatt
gcgctcgatcgcggccaggggttgagggtgtggttcgccatgccggatggcagcattaag
tcggtgcagcccagccgtttgccggagcatgaaacaacctgggcgatgacggtgcataaa
tcgcagggatcggagttcgatcatgcggcgctgattttacccagccagcgctcgccggtt
gtgacccgcgagctggtgtataccgccgtgacgcgcgcacgtcgtcgcctgtctctctat
gccgatgaacgggttttgagtggggcaattgcgacgcgcacggagcgacgtagcggactg
tccgcgttttttaataacgggctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system