KEGG   Citrobacter koseri: CKO_04255Help
Entry
CKO_04255         CDS       T00592                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cko  Citrobacter koseri
Brite
Enzymes [BR:cko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CKO_04255
Secretion system [BR:cko02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CKO_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3946845..3947558)
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAAFSGMVHADDAAIRQSLTKLGVQSTEIQPAPVAGMKTVLTNSGVLYV
TDDGKHIIQGPMYDVSGASPVNVTNQLLMKHLNALEKEMIVYKAPQEKHVITIFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDRNKAFDEAMAGKGVK
AATCDIDIANHYALGVQFGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDAHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgttttatgatgttcaccctgctggcggcggcattttcgggaatggttcat
gcggacgatgcagccattcgccagtcgctgactaagctgggcgtgcagagcacggaaatt
caacccgcgccggttgcaggcatgaaaaccgtgctgaccaacagcggtgtgctgtacgtc
accgacgatggtaagcatattattcaggggccgatgtatgacgtcagcggcgcgtcgccg
gtaaatgtcaccaatcagttgctgatgaaacacctgaatgcgctggaaaaagagatgatt
gtttacaaagcgccgcaggaaaaacatgtcatcaccatctttaccgatatcacctgcggc
tactgtcacaagctgcatgaagagatgaaagactataacgcgctggggattaccgtgcgt
tatctggccttcccgcgccaggggctggaaagccaggccgagcaggatatgaagtccatc
tggtgcgcgaaagaccgaaacaaagcctttgatgaggcgatggcgggcaaaggcgtgaaa
gccgccacctgcgatatcgatatcgccaatcattatgcgctgggcgtgcagttcggcgtg
agcggcacgccagcgattgtgctgagcaacggctatgtggtgcctggctatcaggggccg
aaagagatgaaggcgttccttgacgcgcaccagaaacagaccagcggtaaataa

DBGET integrated database retrieval system