KEGG   Citrobacter koseri: CKO_04265Help
Entry
CKO_04265         CDS       T00592                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cko  Citrobacter koseri
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_04265
Enzymes [BR:cko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CKO_04265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3953284..3954717
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITRQVVAGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPQGDETQPNEEGLKFYDDMFDELL
RYNIEPVITLSHFEMPLHLVQQYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNINMDAGDAE
ILREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPHVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHVEEMMKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGSGDMSRSRKKSFTWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaccttaccaaaagatttcttatggggcggcgcagttgccgctcatcag
gttgaaggcggctggaacaaaggcggcaaagggccgagcatctgtgatgtgctgaccggc
ggagcgcatggcgtaccgcgtgaaatcacccgacaagtcgtagcgggtaaatattatccg
aaccatgaagcggtcgatttttatggtcactataaagaagacattaagctgttcgccgag
atggggtttaaatgctttcgcacctctatcgcctggacccgcattttcccgcagggtgac
gagacgcaaccgaacgaagaagggctgaaattctacgatgatatgttcgatgagttgctc
agatacaacatcgaaccggtcatcaccctctcccactttgaaatgccgctgcatctggta
cagcaatacggcggctggaccaaccgtaaagtggtggatttcttcgtccgcttcgcggag
gtggtatttgagcgctacaagcacaaagtcaaatactggatgaccttcaacgagatcaac
aaccagcgcaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gagcatgaaaacccggaagaaaccatgtatcaggtgctgcatcaccagttcgtcgccagc
gcgctggcggtgaaggcggcacgccgcatcaacccggagatgaaggtcggctgtatgctg
gcgatggtcgcgctctatccgttttcctgtaagccagaagatgtcatgttcgcgcaggaa
tccatgcgcgagcgctatgtgtttaccgacgttcagctacgcggctactacccgtcttat
gtactgaacgaatgggaacgtcgcggctttaacatcaacatggacgctggcgacgcggag
attctgcgcgaaggcacctgcgattaccttggcttcagctattacatgactaacgcagta
aaagcggaaggcggtagcggcgatgccatttccggcttcgagggcagcgtgccgaatccg
cacgtcaaagcttccgactggggctggcagattgacccggtcggcctgcgttattccctg
tgcgagctgtatgaacgctatcagaagccgctgtttattgtggaaaatgggtttggcgcc
tacgacaaagtggaagaagacggcagcatcaacgacgattaccgcatcgactatctgcgt
gctcacgtagaagagatgatgaaagcggtgacgtatgatggtgtggatctgatgggctat
acgccgtggggctgcatcgactgcgtgtcattcacgaccggacaatacagcaagcgttac
ggttttatttacgtgaacaagcatgacgacggtagcggcgatatgtcgcgctcgcggaag
aaaagttttacctggtataaagaggttatcgccagcaacggcgagaagctgtaa

DBGET integrated database retrieval system